!!NA_SEQUENCE 1.0
ID   AF034621   standard; RNA; VRL; 3261 BP.
XX
AC   AF034621;
XX
SV   AF034621.1
XX
DT   08-FEB-1998 (Rel. 54, Created)
DT   06-AUG-2001 (Rel. 68, Last updated, Version 2)
XX
DE   Tobacco rattle virus RNA2, complete sequence.
XX
KW   .
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-3261
RX   MEDLINE; 98411649.
RX   PUBMED; 9739332.
RA   Sudarshana M.R., Berger P.H.;
RT   "Nucleotide sequence of both genomic RNAs of a North American tobacco
RT   rattle virus isolate";
RL   Arch. Virol. 143(8):1535-1544(1998).
XX
RN   [2]
RP   1-3261
RA   Sudarshana M.R., Berger P.H.;
RT   ;
RL   Submitted (17-NOV-1997) to the EMBL/GenBank/DDBJ databases.
RL   Plant, Soil, and Entomological Sciences, University of Idaho, Room 242,
RL   Agricultural Sciences, Moscow, ID 83844-2339, USA
XX
DR   SPTREMBL; O56247; O56247.
DR   SPTREMBL; O56248; O56248.
DR   SPTREMBL; O56249; O56249.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3261
FT                   /chromosome="RNA2"
FT                   /db_xref="taxon:12295"
FT                   /organism="Tobacco rattle virus"
FT                   /isolate="ORY"
FT   promoter        424. .429
FT                   /note="putative; subgenomic"
FT   CDS             522. .1124
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O56247"
FT                   /product="coat protein"
FT                   /protein_id="AAC02063.1"
FT                   /translation="MTDGMYDEEFDSKALNETFSPWVEEKNWKDVLMRLSAMKFALQAD
FT                   RDKIPGVLSDLKKDCPFSAFKRFPDKEMWSKLTKEAVIALAQIQAASSFKRRADEKNAV
FT                   SGLITATPAQASTSNANPSGSATTVVRPPRLDDSSFQEDSFSFGKFDDASTAYHKALSY
FT                   LEGLNLKPLYRRQFEKSYNTRWVPAATPVAPGPRPNP"
FT   promoter        1211. .1216
FT                   /note="putative; subgenomic"
FT   CDS             1237. .2202
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O56248"
FT                   /note="putative 38 kDa protein; proposed to be generated
FT                   from subgenomic mRNA"
FT                   /protein_id="AAC02064.1"
FT                   /translation="MEEYRLWSKNPDYFFSDNAKLFLLHGHHDSPYYKSGEYTVSRSVN
FT                   WGDPEFLMVIGMSRLLTFLSERHLCINVDGNCYSRIQEGLYYYGKFDIYSLMVGNSTQW
FT                   DDFVIYRELMRVHIDFRNVLELLQLAGADRGRLFPRLRELLDLEKVVYSTSKLPDKDIT
FT                   LMIQNLKDQLSATTLENDNLKKEIVMLKSRVEAAQAQAQTRHLENDDLKKQIESLKKKT
FT                   ADVGSISEAIVQVPVVLPAKPTPKVKKYPDDYNNEELSATSKVSDDNDFEHLSPIEKRI
FT                   WGPKEVYHYVKMYYRFPQRNFIDERIVKDKEREDRRASGL"
FT   promoter        2209. .2213
FT                   /note="putative; subgenomic"
FT   CDS             2214. .2690
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O56249"
FT                   /note="putative 18 kDa protein; proposed to be generated
FT                   from subgenomic mRNA"
FT                   /protein_id="AAC02065.1"
FT                   /translation="MTSASIWTLKQGDYPKGSMLIRRRVKNSVLTGKGGYVDLDGNVAV
FT                   GTGWRWEIDFSDLRKLRFSFDSSDTMFGHLRLTFELFTTVNFKSIASYKHEGYKSSPSN
FT                   KLLLLNKVVTNNSYMVTVDEELIRATSFEVVFEWPAPDWTGHLDSVLPSLPSRP"
FT   misc_feature    2698. .3261
FT                   /note="proposed RNA1-derived sequence"
XX
SQ   Sequence 3261 BP; 938 A; 579 C; 787 G; 957 T; 0 other;

AF034621  Length: 3261  December 21, 2001 14:50  Type: N  Check: 7590  ..
       1  ataaaacatt gcaccattgg tgttgccctg gccggggtgt gtctttgaac
      51  gcagtagtat gtgctaattg acaagttgga gaacgcggta gaacgtactt
     101  atccgacacg gccttttatc cctttgttga gaggtttttc tcagccgcaa
     151  tgaaattctg gatttagttg gccgctagaa ggctgaagga atgtagttgt
     201  gtttttagtt tagttaataa gtgtcttcca atacacatta aaccttggac
     251  gtgttagcta cgaaagtgtg taaatttaaa aacaattagt cctccgtgat
     301  taaggatgat taaggctaaa aacgattgtt aatgattttg gcaatcgcat
     351  ccattcgcta tcacaagcga tggtggcatt gacccggaag gtctaatctt
     401  gcggtcattc gactggaaga agcataatta tactgattgt gcaactttgt
     451  gttactattc tgacagtgat tcttgctgaa ctactggtta ctgtatcact
     501  tgcaatcact cacgttccgc gatgacagac ggtatgtacg atgaggagtt
     551  tgatagcaaa gctctcaacg aaacgttttc gccatgggtt gaggagaaga
     601  actggaaaga cgttctaatg aggttgagcg ctatgaaatt tgcgttacaa
     651  gctgacaggg acaaaattcc tggggtttta tcggatctga aaaaggactg
     701  tcctttcagt gcttttaaga ggtttcctga caaagagatg tggtcgaaat
     751  tgacgaagga ggctgtcatt gctttagctc aaattcaagc tgcttcttct
     801  tttaagagga gggcagatga aaagaatgct gtttctgggt tgattactgc
     851  aacacctgct caagcttcta ctagtaacgc gaacccaagt ggttcagcaa
     901  ccacagtggt gagaccacca aggttggacg actcgtcttt ccaagaggat
     951  agcttttctt ttggtaagtt cgatgacgct tctactgcgt atcataaagc
    1001  tctctcctat ttggaaggtt taaatttgaa accgttatat aggagacagt
    1051  ttgagaaatc gtacaacact aggtgggttc ctgctgccac tccggtggcg
    1101  cctgggccgc gtccgaatcc ctaattctaa gtttgtcaga tactctttca
    1151  gagggtcacg tgaaaatcgt gaggtggtgt ttaccatata acataatgtc
    1201  atatgtgggc atttaaaata atcacactgc tgcgagatgg aggagtatag
    1251  gctttggtca aagaatccgg attatttctt ttccgacaat gcaaaactgt
    1301  tcttactgca tgggcatcac gatagtccgt attataagag cggggaatac
    1351  actgtttctc gttcggttaa ttggggagat cctgaatttc ttatggtaat
    1401  tggaatgtct agacttttaa ctttcctatc agaaagacat ttatgtatca
    1451  atgtggacgg gaattgttat tcacggatcc aagagggtct gtattactat
    1501  ggaaagtttg acatttactc gttgatggtt ggaaatagta ctcagtggga
    1551  tgatttcgta atttatagag agctaatgag agttcacatc gactttcgta
    1601  acgtgttaga acttcttcag ctggctggcg ctgatagagg tcgactgttt
    1651  cctaggttgc gagaattgtt agacctcgaa aaagtcgttt attcgacgtc
    1701  aaaactaccg gacaaagata ttacgctgat gatacaaaat ctcaaagatc
    1751  agttgtctgc gacgacttta gagaacgaca atttgaagaa agagatcgtc
    1801  atgctgaaga gtcgagtcga agctgcacaa gcgcaagctc agactagaca
    1851  tctcgaaaac gacgatctga agaaacaaat cgagtcgttg aagaagaaaa
    1901  ccgcagatgt gggaagtatc tctgaagcta ttgttcaagt accggtggtg
    1951  ttgcctgcga agccgactcc taaagttaag aagtatcccg atgattacaa
    2001  caacgaggaa ctgagtgcaa cgtcaaaggt aagcgatgat aatgatttcg
    2051  agcatttatc accaattgaa aaaagaattt ggggccctaa ggaagtatat
    2101  cattatgtta agatgtatta cagattccca cagaggaatt tcatagacga
    2151  acgcattgtc aaagacaagg aaagagaaga cagacgcgca agcggtctgt
    2201  agaccggcat aaaatgacga gcgcatccat ctggacccta aaacagggtg
    2251  attacccgaa gggttctatg ttaattcgta ggagggttaa aaattctgtc
    2301  ttgactggaa aaggtggtta cgtagatctg gacggtaatg tagcggtcgg
    2351  aactggatgg cgatgggaaa tcgactttag tgacctgcgt aagctgcgat
    2401  tttcgtttga ttcttcagat actatgtttg gtcatttacg gttaactttt
    2451  gaactattca ctacggtgaa ttttaagtca atagcctctt ataagcacga
    2501  aggttacaag tcgtcaccgt cgaataagct gttgcttctc aacaaggtag
    2551  tgaccaacaa tagttatatg gtgacggtag acgaagaact cataagagcg
    2601  acttcttttg aagttgtctt cgaatggcct gcaccagatt ggaccggtca
    2651  cttggactca gtgcttcctt cactaccttc aagaccttaa gggttgacgt
    2701  aggtgcgcgg agagtaattg tggatggttt gtctgtatta ttatcaatga
    2751  ttttactttt gatatgtata attgttgtgg ccgtagccac cttggaaaat
    2801  gtcgtagacg cgttgaagca agaaatcgag agttctggaa acagattcga
    2851  cgaaatcaag ctgaaaacac gtcttcgaca cctaaaaagt ctcataattc
    2901  gaagacctct aagaagaaat tcaaaggggt cagagaattc ggggcaccaa
    2951  aaagattttt aagagatgat gttccgttag gaattgatca attatttgct
    3001  tttaaatttt gttttaaatt gttatccgtt tctgtgtata gactgtttga
    3051  gattggcgct tggccgactc attgtcttac cataggggaa cggactttgt
    3101  ttgtgttgtt attttatttg tattttatta aaattctcaa tgatctgaaa
    3151  aggcctcgag gctaagagat tattgggggg tgagtaagta cttttaaagt
    3201  gatgatggtt acaaaggcaa aaggggtaaa acccctcgcc tacgtaagcg
    3251  ttattacgcc c