!!NA_SEQUENCE 1.0
ID   AF034622   standard; RNA; VRL; 6790 BP.
XX
AC   AF034622;
XX
SV   AF034622.1
XX
DT   08-FEB-1998 (Rel. 54, Created)
DT   06-AUG-2001 (Rel. 68, Last updated, Version 3)
XX
DE   Tobacco rattle virus RNA polymerase, 29 kDa protein, and 16 kDa protein
DE   genes, complete cds.
XX
KW   .
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-6790
RX   MEDLINE; 98411649.
RX   PUBMED; 9739332.
RA   Sudarshana M.R., Berger P.H.;
RT   "Nucleotide sequence of both genomic RNAs of a North American tobacco
RT   rattle virus isolate";
RL   Arch. Virol. 143(8):1535-1544(1998).
XX
RN   [2]
RP   1-6790
RA   Sudarshana M.R., Berger P.H.;
RT   ;
RL   Submitted (17-NOV-1997) to the EMBL/GenBank/DDBJ databases.
RL   Plant, Soil, and Entomological Sciences, University of Idaho, Room 242,
RL   Agricultural Sciences, Moscow, ID 83844-2339, USA
XX
DR   SPTREMBL; O56250; O56250.
DR   SPTREMBL; O56251; O56251.
DR   SPTREMBL; O56252; O56252.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6790
FT                   /chromosome="RNA1"
FT                   /db_xref="taxon:12295"
FT                   /organism="Tobacco rattle virus"
FT                   /isolate="ORY"
FT   CDS             202. .5325
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O56250"
FT                   /note="readthrough protein"
FT                   /transl_except=(pos:3763. .3765,aa:OTHER)
FT                   /product="RNA polymerase"
FT                   /protein_id="AAC02066.2"
FT                   /translation="MANGNFKLSQLLNVDEMSAEQRSHFFDLMLTKPDCEIGQMMQRVV
FT                   VDKVDDMIRERKTKDPVIVHEVLSQKEQNKLMEIYPEFNIVFKDDKNMVHGFAAAERKL
FT                   QALLLLDRVPALQEVDDIGGQWSFWVTRGEKRIHSCCPNLDIRDDQREISRQIFLTAIG
FT                   DQARSGKRQMSENELWMYDQFRENIAAPNAVRCNNTYQGCTCRGFSDGKKKGAQYAIAL
FT                   HSLYDFKLKDLMATMVEKKTKVVHAAMLFAPESMLVDEGPLPSVDGYYMKKNGKIYFGF
FT                   EKDPSFSYIHDWEEYKKYLLGKPVSYQGNVFYFEPWQVRGDTMLFSIYRIAGVPRRSLS
FT                   SQEYYRRIYISRWENMVVVPIFDLVESTRELVKKDLFVEKQFMDKCLDYIARLSDQQLT
FT                   ISNVKSYLSSNNWVLFINGAAVKNKQSVDSRDLQLLAQTLLVKEQVARPVMRELREAIL
FT                   TETKPITSLTDVLGLISRKLWKQFANKIAVGGFVGMVGTLIGFYPKKVLTWAKDTPNGP
FT                   ELCYENSHKTKVIVFLSVVYAIGGITLMRRDIRDGLVKKLCDMFDIKRGAHVLDVENPC
FT                   RYYEINDFFSSLYSASESGETVLPDLSEVKAKSDKLLQQKKEIADEFLSAKFSNYSGSS
FT                   VRTSPPSVVGSSRSGLGLLLEDSNVLTQARVGVSRKVDDEEIMEQFLSGLIDTEAEIDE
FT                   VVSAFSAECERGETSGTKVLCKPLTPPGFENVLPAVKPLVSKGKTVKRVDYFQVMGGER
FT                   LPKRPVVSGDNSVDARREFLYYLDAERVAQNDEIMSLYRDYSRGVIRTGGQNYPHGLGV
FT                   WDVEMKNWCIRPVVTEHAYVFQPDKRMDDWSGYLEVAVWERGMLVNDFAVERMSDYVIV
FT                   CDQTYLCNNRLILDNLSALDLGPANCSFELVDGVPGCGKSTMIVNSANPCVDVVLSTGR
FT                   AATDDLIERFASKGFPCKLKRRVKTVDSFLMHCVDGSLTGDVLHFDEALMAHAGMVYFC
FT                   AQIAGAKRCICQGDQNQISFKPRVSQVDLRFSSLVGKFDIVTEKRETYRSPADVVAVLN
FT                   KYYTGDVRTHNATANSMTVRKIVSKEQVSLKPGAQYITFLQSEKKELVNLLALRKVAAK
FT                   VSTVHESQGETFKDVVLVRTKPTDDSIARGREYLIVALSRHTQSLVYETVKEDDVSKEI
FT                   RESAALTKAALARFFVTETVLXRFRSRFDVFRHHEGPCAVPDSGTITDLEMWYDALFPG
FT                   NSLRDSSLDGYLVATTDCNLRLDNVTIKSGNWKDKFAEKEAFLKPVIRTAMPDKRKTTQ
FT                   LESLLALQKRNQAAPDLQENVHATVLIEETMKKLKSVVYDVGKIRADPIVNRAQMERWW
FT                   RNQSTAIQAKVVADVRELHEIDYSSYMYMIKSDVKPKTDLTPQFEYSALQTVVYHEKLI
FT                   NSLFGPIFKEINERKLDAMQPHFVFNTRMSSSDLNDRVKFLNTEAAYDFVEIDMSKFDK
FT                   SANRFHLQLQLEIYRLFGLDEWAAFLWEVSHTQTTVRDIQNGMMAHIWYQQKSGDADTY
FT                   NANSDRTLCALLSELPLEKAVMVTYGGDDSLIAFPRGTQFVDPCPKLATKWNFECKIFK
FT                   YDVPMFCGKFLLKTSSCYEFVPDPVKVLTKLGKKSIKDVQHLAEIYISLNDSNRALGNY
FT                   MVVSKLSESVSDRYLYKGDSVHALCALWKHIKSFTALCTLFRDENDKELNPAKVDWKKA
FT                   QRAVSNFYDW"
FT   CDS             5327. .6085
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O56251"
FT                   /note="29 kDa protein"
FT                   /protein_id="AAC02067.1"
FT                   /translation="MEDKSLVTLKKKTFEVSKFSNLGAIELFVDGRRKRPKYFHRRRET
FT                   VLNHVGGKKSEHKLDVFDQRDYKMIKSYAFLKIVGVQLVVTSHLPADTPGFIQIDLLDS
FT                   RLTEKGKKGKTIQRFKARARDNCSVAQYKVEYSISTQENVLDVWKVGCISEGVPVCDGT
FT                   YPFSIEVSLIWVATDSTRRLNVEELNSSDYIEGDFTDQEVFGEFMSLKQVEMKTIEAKY
FT                   DGPYRPATTRPKSLLSSEDVKRASNKKNSS"
FT   CDS             6110. .6535
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O56252"
FT                   /note="16 kDa protein"
FT                   /protein_id="AAC02068.1"
FT                   /translation="MTCVPKGCVNEVTVLGHETCSIGHANKLRKQVADMVGVTRRCAEN
FT                   NCGWFVCVVINDFTFDVYNCCGRSHLEKCRKRVETRNREIWKQTRRNQAENMSATTKKS
FT                   HNSKTSKKKFKEDREFGTPKRFLRDDVPFGIDRVFAF"
XX
SQ   Sequence 6790 BP; 1996 A; 1130 C; 1737 G; 1927 T; 0 other;

AF034622  Length: 6790  December 21, 2001 14:50  Type: N  Check: 1165  ..
       1  ataaaacatt tcaatccttt gaacgcggta gaacgtgcta attggatttt
      51  ggtgagaacg cggtagaacg tacttatcac ctacagtttt attttgtttt
     101  tctttctggt ttaatctatc cagcttagta ccgagtgggg aaagtgactg
     151  gtgtgcctaa aaccttttct ttgatacttt gtaaaaatac atacagatac
     201  aatggcgaac ggtaacttca agttgtctca attgctcaat gtggacgaga
     251  tgtctgctga gcagaggagt catttctttg acttgatgct gactaaacct
     301  gattgtgaga tcgggcaaat gatgcaaaga gttgttgttg ataaagtcga
     351  tgacatgatt agagaaagaa agactaaaga tccagtgatt gttcatgaag
     401  ttctttctca gaaggaacag aacaagttaa tggaaattta tcctgaattc
     451  aatatcgtgt tcaaagacga caaaaacatg gttcatgggt ttgcggcagc
     501  tgagcgaaaa ctacaagctt tattgctttt agatagagtt cctgctctgc
     551  aagaggtgga tgacatcggt ggtcaatggt cgttttgggt aactagaggt
     601  gagaaaagga ttcattcctg ttgtccaaat ctagatattc gggatgatca
     651  gagagaaatt tctcgacaga tatttcttac tgctattggt gatcaagcta
     701  gaagtggtaa gagacagatg tcggagaatg aattgtggat gtatgaccaa
     751  tttcgtgaaa atattgctgc gcctaacgcg gttaggtgca ataatacata
     801  tcagggttgt acatgtagag gtttttctga tggtaagaag aaaggcgcgc
     851  agtatgcgat agctcttcac agcctgtatg acttcaagtt gaaagacttg
     901  atggctacta tggttgagaa gaaaactaaa gtggttcatg ctgctatgct
     951  ttttgctcct gagagtatgt tagtggacga aggtccatta ccttctgttg
    1001  acggttacta catgaagaag aacgggaaga tctatttcgg ttttgagaaa
    1051  gatccttcct tttcttacat tcatgactgg gaagagtaca agaagtatct
    1101  actggggaag ccagtgagtt accaagggaa tgtgttctac ttcgaaccgt
    1151  ggcaggtgag aggagacacg atgctttttt cgatctacag gatagctgga
    1201  gttccgagga ggtctctatc atcgcaagag tactaccgaa gaatatatat
    1251  cagtagatgg gaaaacatgg ttgttgtccc aattttcgat ctggtcgaat
    1301  caacgcgaga gttggtcaag aaagacctgt ttgtagagaa acaattcatg
    1351  gacaagtgtt tggattacat agctaggtta tctgaccagc agctgaccat
    1401  aagcaatgtc aaatcatact tgagttcaaa taattgggtc ttattcataa
    1451  acggggcggc cgtgaagaac aagcaaagtg tagattctcg agatttacag
    1501  ttgttggctc aaactttgct agtgaaggaa caagtggcga gacctgtcat
    1551  gagggagttg cgtgaagcaa ttctgactga gacgaaacct atcacgtcat
    1601  tgactgatgt gctgggttta atatcaagaa aactgtggaa gcagtttgct
    1651  aacaagatcg cagtcggcgg attcgttggc atggttggta ctctaattgg
    1701  attctatcca aagaaggtac taacctgggc gaaggacaca ccaaatggtc
    1751  cagaactatg ttacgagaac tcgcacaaaa ccaaggtgat agtatttctg
    1801  agtgttgtgt atgccattgg aggaatcacg cttatgcgtc gagacatccg
    1851  agatggactg gtgaaaaaac tatgtgatat gtttgatatc aaacgggggg
    1901  cccatgtctt agacgttgag aatccgtgcc gctattatga aatcaacgat
    1951  ttctttagca gtctgtattc ggcatctgag tccggtgaga ccgttttacc
    2001  agatttatcc gaggtaaaag ccaagtctga taaactattg cagcagaaga
    2051  aagaaatcgc tgacgagttt ctaagtgcaa aattctctaa ctattctggc
    2101  agttcggtga gaacttctcc accatcggtg gtcggttcat ctcgaagcgg
    2151  actgggtctg ttgttggaag acagtaacgt gctgacccaa gctagagttg
    2201  gagtttcaag aaaggtagac gatgaggaga tcatggagca gtttctgagt
    2251  ggtcttattg acactgaagc agaaattgac gaggttgttt cagccttttc
    2301  agctgaatgt gaaagagggg aaacaagcgg tacaaaggtg ttgtgtaaac
    2351  ctttaacgcc accaggattt gagaacgtgt tgccagctgt caaacctttg
    2401  gtcagcaaag gaaaaacggt caaacgtgtc gattacttcc aagtgatggg
    2451  aggtgagaga ttaccaaaaa ggccggttgt cagtggagac aattctgtgg
    2501  acgctagaag agagtttctg tactacttag atgcggagag agtcgctcaa
    2551  aatgatgaaa ttatgtctct gtatcgtgac tattcgagag gagttattcg
    2601  aactggaggt cagaattacc cgcacggact gggagtgtgg gatgtggaga
    2651  tgaagaactg gtgcatacgt ccagtggtca ctgaacatgc ttatgtgttc
    2701  caaccagaca aacgtatgga tgactggtcg ggatacttag aagtggctgt
    2751  ttgggaacga ggtatgttgg tcaacgactt cgcggtcgaa aggatgagtg
    2801  attatgtcat agtttgcgat cagacgtatc tttgcaataa caggttgatc
    2851  ttggacaatt taagtgccct ggatctagga ccagctaact gttcttttga
    2901  attagttgac ggtgtacctg gttgcggtaa gtcgacaatg attgtcaact
    2951  cagctaatcc ttgtgtcgat gtggttctct ctactgggag agcagcaacc
    3001  gacgacttga tcgagagatt cgcgagcaaa ggttttccat gcaaattgaa
    3051  aaggagagtg aagacggttg attctttttt gatgcattgt gttgatggtt
    3101  ctttaaccgg agacgtgttg catttcgatg aagcactcat ggcccatgct
    3151  ggtatggtat acttttgcgc tcagatagct ggtgctaaac gatgtatctg
    3201  tcaaggagat cagaatcaaa tttctttcaa gcctagggta tctcaagttg
    3251  atttgaggtt ttctagtctg gtcggaaagt ttgacattgt tacagaaaaa
    3301  agagaaactt acagaagtcc agcagatgtg gttgccgtat tgaacaagta
    3351  ctatactgga gatgtcagaa cacataacgc gactgctaat tcgatgacgg
    3401  tgaggaagat tgtgtctaaa gaacaggttt ctttgaagcc tggtgctcag
    3451  tacataactt tccttcagtc tgagaagaag gagttggtaa atttgttggc
    3501  attgaggaaa gtggcagcta aagtgagtac agtacacgag tcgcaaggag
    3551  agacattcaa agatgtagtc ctagtcagga cgaaacctac ggatgactca
    3601  atcgctagag gtcgggagta cttaatcgtg gcgttgtcgc gtcacacaca
    3651  atcacttgtg tatgaaactg tgaaagagga cgatgtaagt aaagagatca
    3701  gggaaagtgc cgcgcttacg aaggcggctt tggcaagatt ttttgttact
    3751  gagaccgtct tatgacggtt tcggtctagg tttgatgttt ttagacatca
    3801  tgaagggcct tgcgccgttc cagattcagg tacgattacg gacttggaga
    3851  tgtggtacga cgctttgttt ccaggaaatt cgttaagaga ctcaagccta
    3901  gacgggtatt tggtggcaac gactgattgc aatttgcgat tagacaatgt
    3951  tacgatcaaa agtggaaact ggaaagacaa gtttgctgaa aaagaagcgt
    4001  ttctgaaacc ggttattcgt actgctatgc ctgacaaaag gaagactact
    4051  cagttggaga gtttgttagc attgcagaaa aggaaccaag cggcacccga
    4101  tctacaagaa aatgtgcacg caacagttct aatcgaagag acgatgaaga
    4151  agctgaaatc tgttgtctac gatgtgggaa agattcgggc tgatcctatt
    4201  gtcaatagag ctcaaatgga gagatggtgg agaaatcaaa gcacagcgat
    4251  acaggctaag gtagtagcag atgtgagaga gttacatgaa atagactatt
    4301  cgtcttatat gtatatgatc aaatctgacg tgaaacctaa gactgattta
    4351  acaccgcaat ttgaatactc agctctacag actgttgtgt atcacgagaa
    4401  gttgatcaac tcgttgttcg gtccaatttt caaagaaatt aatgaacgca
    4451  agttggatgc tatgcaacca cattttgtgt tcaacacgag aatgtcatcg
    4501  agtgatttaa acgatcgagt gaagttctta aatacggaag cggcttacga
    4551  ctttgttgag atagacatgt ctaaattcga caagtcggca aatcgcttcc
    4601  atttacaact gcagttggag atttacaggt tatttgggct agatgagtgg
    4651  gcggccttcc tttgggaggt gtcgcacact caaactactg tgagagatat
    4701  tcaaaatggt atgatggcgc atatttggta ccaacaaaag agtggagatg
    4751  ctgatactta taatgcgaat tcagatagga cactgtgtgc actcttgtct
    4801  gaattaccat tggagaaagc agtcatggtt acatatggag gagatgactc
    4851  actgattgcg tttcctagag gaacacagtt tgttgatccg tgtccaaagt
    4901  tggctactaa atggaatttc gagtgcaaga tttttaagta cgatgtccca
    4951  atgttttgtg ggaagttctt gcttaagacg tcatcgtgtt acgagttcgt
    5001  gccagatccg gtaaaagttc tgacgaagtt ggggaaaaag agtataaagg
    5051  atgtgcaaca tttagccgag atctacatct cgctgaatga ttccaataga
    5101  gctcttggga actacatggt ggtatccaaa ctgtccgagt ctgtttcaga
    5151  ccggtatttg tacaaaggtg attctgttca tgcgctttgt gcgctatgga
    5201  agcatattaa gagttttaca gctctgtgta ctttattccg agacgaaaac
    5251  gataaggaat tgaacccggc taaggttgat tggaagaagg cacagagagc
    5301  tgtgtcaaac ttttacgact ggtaatatgg aagacaagtc attggttacc
    5351  ttgaagaaga agactttcga agtctcaaaa ttctcaaatc taggggccat
    5401  tgaattgttt gtggacggta ggaggaagag accgaagtat tttcacagaa
    5451  gaagagaaac tgtcctaaat catgttggtg ggaagaagag tgaacacaag
    5501  ttagacgttt ttgaccaaag ggattacaaa atgattaaat cttacgcgtt
    5551  tctaaagata gtaggtgtac aactagttgt aacatcacat ctacctgcag
    5601  atacgcccgg gttcattcaa atcgatctgt tggattcgag acttactgag
    5651  aaaggaaaga aaggaaagac tattcagaga ttcaaagctc gagctcgcga
    5701  taactgttca gttgcgcagt acaaggttga atacagtatt tccacacagg
    5751  agaatgtact tgatgtctgg aaggtgggtt gtatttctga gggcgttccg
    5801  gtctgtgacg gtacataccc tttcagtatc gaagtgtcgc taatatgggt
    5851  tgctactgat tcgactaggc gcctcaatgt ggaagaactg aacagttcgg
    5901  attacattga aggcgatttt accgatcaag aggttttcgg tgagttcatg
    5951  tctttgaaac aagtggagat gaagacgatt gaggcgaagt atgatggtcc
    6001  ttacagacca gctactacta gacctaagtc attattgtca agtgaagatg
    6051  ttaagagagc gtctaataag aaaaactcgt cttaatgcat aaagaaattt
    6101  attgtcaata tgacgtgtgt acccaagggt tgtgtgaatg aagtcactgt
    6151  tcttggtcac gagacgtgta gtatcggtca tgctaacaaa ttgcgaaagc
    6201  aagttgctga catggttggt gtcacacgta ggtgtgcgga aaataattgt
    6251  ggatggtttg tctgtgttgt tatcaatgat tttacttttg atgtgtataa
    6301  ttgttgtggc cgtagtcacc ttgaaaagtg tcgtaaacgt gttgaaacaa
    6351  gaaatcgaga aatttggaaa caaactcgac gaaatcaagc tgaaaacatg
    6401  tctgcgacaa ctaaaaagtc tcataattcg aaaacctcta agaagaaatt
    6451  caaagaggac agagaatttg ggacaccaaa aagattttta agagatgatg
    6501  ttcctttcgg gattgatcgt gtgtttgctt tttgatttta ttttatattg
    6551  ttatctgttt ctgtgtatag actgtttgag attggcgttt ggccgactca
    6601  ttgtcttacc atagggggac agactttgtt tgtgttgtta ttttatttgt
    6651  attttattaa aattctcaat gatctgaaaa ggcctcgagg ctaagagatt
    6701  attggggggt gagtaagtac ttttaaagtg atgatggtta caaaggcaaa
    6751  aggggtaaaa cccctcgcct acgtaagcgt tattacgccc