!!NA_SEQUENCE 1.0
ID   AF036338   standard; RNA; VRL; 1377 BP.
XX
AC   AF036338;
XX
SV   AF036338.1
XX
DT   22-JUN-1998 (Rel. 56, Created)
DT   22-JUN-1998 (Rel. 56, Last updated, Version 1)
XX
DE   Citrus psorosis virus coat protein (cp) gene, complete cds.
XX
KW   .
XX
OS   Citrus psorosis virus
OC   Viruses; ssRNA negative-strand viruses; Ophiovirus.
XX
RN   [1]
RP   1-1377
RA   Barthe G.A., Ceccardi T.L., Manjunath K.L., Derrick K.S.;
RT   "Citrus psorosis virus: nucleotide sequencing of the coat protein gene and
RT   detection by hybridization and RT-PCR";
RL   J. Gen. Virol. 79:1531-1537(1998).
XX
RN   [2]
RP   1-1377
RA   Barthe G.A., Ceccardi T.L., Manjunath K.L., Derrick K.S.;
RT   ;
RL   Submitted (01-DEC-1997) to the EMBL/GenBank/DDBJ databases.
RL   IFAS-CREC, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
DR   SPTREMBL; O89526; O89526.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1377
FT                   /db_xref="taxon:73561"
FT                   /organism="Citrus psorosis virus"
FT                   /isolate="4e"
FT                   /lab_host="Citrus sinensis and Citrus paradisi"
FT   CDS             12. .1331
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89526"
FT                   /gene="cp"
FT                   /function="encapsidates viral RNA"
FT                   /product="coat protein"
FT                   /protein_id="AAC41022.1"
FT                   /translation="MSIPIKVSQLIDAKAKWESDKENCPAEITTLLKTYGVLRETGALS
FT                   SKSTAYLAGLSKDKRVILTDEGLAEFKNVENPHDQGEKPTFSLASSSNIKITDIEVIKQ
FT                   KMEQETFQIDQLKLKEQIENFIKTVTLDDESYTEGEIVIKHFGNPDAELNMLVTAGTKI
FT                   LDGLVYVSMKGDTKSLNLFKMEQVDGVCDSDIVKNIRVAKRAIQAAFVLVFTQGSLPGK
FT                   ADDKRKVPEFVKSKLYDGDVSLSQISEELSHAPTKKFPARVFLKIDIDNLPSAVCSRCK
FT                   LNIAGNRSVRYASFASSFQTKQKLSPAVGATPESLMPLLETNQKIEKAIAIRDFLKTME
FT                   GQWKNQKRLHPLSDEKPTIKNFTLKLTCAIIYSLTPDGRTDMAERIISDNNKGFQNDRN
FT                   FFGDGEGPIRTWSVLTKPEADFSNITVDGLKGIFGVAATM"
XX
SQ   Sequence 1377 BP; 463 A; 243 C; 312 G; 359 T; 0 other;

AF036338  Length: 1377  December 21, 2001 14:50  Type: N  Check: 3914  ..
       1  aagaactgaa aatgtcgatt cctattaaag tgtcacagct gattgatgcc
      51  aaagcaaaat gggaaagtga caaagagaat tgccctgctg aaataacaac
     101  tctcctgaaa acatatggag ttctgagaga gactggagca ttaagctcaa
     151  aaagcacagc ttatctggct ggattgtcaa aagacaagag agtaatccta
     201  actgatgaag gattagcaga gttcaaaaat gttgaaaatc ctcatgatca
     251  gggagagaag ccaacatttt cattggcctc atccagcaac atcaagataa
     301  ctgatataga ggttatcaaa cagaaaatgg agcaggagac ttttcaaatt
     351  gatcaactga agctcaagga acaaattgag aattttatca aaacagtgac
     401  tcttgatgat gaatcttata ctgagggtga gatagtcatc aagcattttg
     451  gtaacccaga tgctgagctc aatatgcttg tgactgctgg aacaaaaata
     501  ctggatggtc tagtatatgt ttcaatgaaa ggagacacta aatcactcaa
     551  cttgttcaag atggagcaag ttgatggggt ctgtgattct gatattgtca
     601  aaaatatcag ggtagccaag agagcaattc aagctgcttt tgtacttgtt
     651  ttcacacaag ggtcgcttcc tggaaaagct gatgacaaaa ggaaagttcc
     701  tgaatttgtc aagtcaaaac tgtatgatgg tgacgtgagt ttgtcacaaa
     751  tcagtgagga gttgagccat gctccaacca agaaattccc tgcaagggta
     801  tttctcaaga ttgatattga taacttgcca agtgctgttt gctccagatg
     851  caaactgaat attgctggaa atcgatctgt gaggtatgcc agctttgcaa
     901  gcagctttca aacaaagcaa aagttgtccc ctgctgttgg tgcaactcct
     951  gagtccttga tgcctttact agaaacaaac cagaagattg agaaggcaat
    1001  tgcaattagg gatttcctaa aaacgatgga aggtcaatgg aaaaaccaga
    1051  agcgactcca ccccttatct gatgagaaac cgacaatcaa gaacttcacc
    1101  ttgaagctaa catgcgctat aatctacagc ctcactccag atggaagaac
    1151  tgacatggca gagaggataa tatccgacaa taataagggg tttcagaatg
    1201  ataggaactt ttttggtgat ggtgaagggc caataaggac atggagtgtg
    1251  ttgacaaaac cagaggcaga tttcagcaat ataacagtag acggtctcaa
    1301  aggtatcttt ggggtggctg cgactatgta attcgattct ttattaatgc
    1351  tgtgtgcttg catgttatgc ttttaaa