ID   AF057533   standard; genomic RNA; VRL; 9384 BP.
XX
AC   AF057533;
XX
SV   AF057533.1
XX
DT   16-APR-1998 (Rel. 55, Created)
DT   23-NOV-2005 (Rel. 85, Last updated, Version 3)
XX
DE   Wheat streak mosaic virus strain Sidney 81, complete genome.
XX
KW   .
XX
OS   Wheat streak mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Tritimovirus.
XX
RN   [1]
RP   1-9384
RA   Stenger D.C., Hall J.S., Choi I.-R., French R.;
RT   "Phylogenetic Relationships Within the Family Potyviridae: Wheat Streak
RT   Mosaic Virus and Brome Streak Mosaic Virus Are Not Members of the Genus
RT   Rymovirus";
RL   Phytopathology 88:782-787(1998).
XX
RN   [2]
RP   1-9384
RX   PUBMED; 16181653.
RA   French R., Stenger D.C.;
RT   "Population structure within lineages of Wheat streak mosaic virus derived
RT   from a common founding event exhibits stochastic variation inconsistent
RT   with the deterministic quasi-species model";
RL   Virology 343(2):179-189(2005).
XX
RN   [3]
RP   1-9384
RA   Stenger D.C., Hall J.S., Choi I.-R., French R.;
RT   ;
RL   Submitted (05-APR-1998) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS, University of Nebraska, Lincoln, 344 Keim Hall, Lincoln, NE
RL   68583, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .9384
FT                   /db_xref="taxon:31741"
FT                   /mol_type="genomic RNA"
FT                   /organism="Wheat streak mosaic virus"
FT                   /strain="Sidney 81"
FT   CDS             131. .9238
FT                   /codon_start=1
FT                   /db_xref="GOA:O72347"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001456"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="UniProtKB/TrEMBL:O72347"
FT                   /product="polyprotein"
FT                   /protein_id="AAC13692.1"
FT                   /translation="MATANCLLGDFGRQGVVANDPYVQCRARTLIFLSTEEEVDVVVNH
FT                   HGPGSIFWSKEGILTQTAKNLYKATAYGLGYDLAANVFVCGKCRSSCTQYRYFIEDHFA
FT                   CDKLVEKNCAYIKDDKYVKVVEAFPIMPSYATPGQETRIIQWMNKTSQCLADHCIQRTR
FT                   EITFTNSKTQEEETRVKDCSLEVFYDDFDEAHAVIEHAHRKNPVHEYKEKQLRMTSNNI
FT                   AALVDQVTRMMHSKGKTVEIVGSKGHKKFAKIPLKHTMGYPKRDWDATKDIPEDFRGFI
FT                   TTYSGVIQYTRKVQDHEVTLGWSGVLLSEMDVPDGYQEDCVDGLFIVMGRCAHGRIQNA
FT                   LKPKCTHGLRWYGDQAVNKVIPKYHDVCNNNCASYLEALPRKVSRVWQSMFDIHNLRCD
FT                   QCRTEWKMRTASEHLQLLQKSVEHYMQTYPDSDVTLFKAFLQALGPDEEVEARQLKPNN
FT                   TLQLVDVWRTMKNTINIPNRIIYMGMFTDNYGNFDFFPNTSMPELFAMHMQPVQHKMLE
FT                   DGTIETNFRFVDLEGKIQTSIESLYPTFDSTYWNEQARRVHRIQPLADCSMEINGESKP
FT                   ICHWEGNVPLYNPIIRATPGQLPFGVTTHLLSVNDRSGRFHYVPKNGYCYMYIFACAMI
FT                   FCGNSNRSTVDAFVRQVCEDLGPWPMFGDVLRQLDWMATFYGCYDALVPVILVDHTRKT
FT                   MHVPTPYGIKQSGMHTIRVNTVLELITLDTMASGAMKDYKIGGFQETVLSIQACVKSRK
FT                   EFVRKINKDAEWLVDMFINPSTLFVLGGLIEVHQVILADVENSFDKSAALLNLRQIALK
FT                   LGPHLESKQRVRQYMELMIQHRASVEAIIPSQHMKAEMMQYIDALQRSILEEQVIIEMD
FT                   RVGGKEKMLVEQDLSHAECAYNEFFNSIGYLNFHGTVLRLTYSGPGRKVGEVLESLRDN
FT                   WLTRYLRGPKQPRDYKGSSLRIWRKVTHLCGNAYRWVFYNMAANVLQVILIGLSTVFGA
FT                   YLLKKILKMLQWEKEQESTELVEYQGKREEAWITRVMAVLYIIASLFSVDFSSALYSNL
FT                   VKFRTIFDILKFNCEYQSGIFESLKNQLGNIPAFHEVHLYDHEATQVAVPPAILTFERW
FT                   FETRITSGQQGYAPLDGSHVSLTMTKDTVGEIATQVQTHKAKEFLIIGHVGCGKSTAFP
FT                   ATLSRNGRVMICEPTRVLVTNLQDSMLATRNLSISAMMRNHRVMTASNITVTTYGYALH
FT                   YLYNNSHNLSEYDYILFDEVHQTSAEMLVFYNWLKSTTWEGKLIKLTATNNTVNGDMQT
FT                   QQALDVKTWPVMDHRTFMQEQGRGTAHDASTLGDVIIVFLTSFREIDESADILSKNSKI
FT                   GVIKADSRHLRNKISLMDDVEALRAEKKYILATNILQNGVNLHADVVVDFGFKIVPAID
FT                   SDNRMITVKRQLINKSDRIQRLGRVGRMKMGYARKIGNEIDASFALDEVTATEAALLAF
FT                   GLGVAPVLQNVDQHTFGKITAEQVRTAARFEMQLSYMVWMINRDGTMATRLYEQFKSLL
FT                   LTPGNTSLAPYYETLVDTHRFRTIGQYATLGYMRTDEKHHLVLPFHHNDVSVEFAERIG
FT                   EAYMASQVPTSIKLRVPAVNHREVAMKMSANPEDVGTILYMVEQALISEKTKLENLTQA
FT                   FQQQQSTYCSVLIPNFNVAGRLTQAMDRIRKNVSVLQHQKTALEKAAVTYDYTKLVELL
FT                   DENPSIASHVSYQAGPAKFIDEFILEKRDYGWLPYLAVGTACAIAGTTLVMMYYRRMKR
FT                   SVKFEGKAARNRSAKRQSARDQKMERGNEYTYYDAGDTLYNGVQENMNHAPDWTDRIKK
FT                   KTHAYAMQFGREVPKTETQRSSQYWHFYGFDPKMYDSVEFKDIAANFSVHQDAKAMDLQ
FT                   KAFTEMVENRWDDEDFFDEKIPKRVLAIFRKGDKVREVALAPHKPNQVNKRGLPVGHAD
FT                   HRGEWRQTQPSFEKEVSYENKSTFEGARSLDHIHQNQVILVEDNQQLNGLIVGNILLAP
FT                   YHFTRGMRNREEKETRMLTQFGTYNLGKLTNKHVTKFTMMDLVALTLPPTFQARRKLKC
FT                   FRPPREGERAMLVTMQYEKAGWVAKQSAETTITPFGDRHDGLWKHRISTGPGDCGSAIV
FT                   AVADLKVVGFHNLGGKGENYFTPITIEVMDFLAEKSVTPLVPWKFSDEQVDLCGLIAAN
FT                   GADKYPFTKTISDLVSWQSLQMTKYCGENFKAIAYAPNRMSKRHVITGKRPEFIKFLDS
FT                   HPKWNATVTPFLNGFQPSVLTHEAYYKDVLKYNKDIIVGGTDEVCFAKAVVATIGILEI
FT                   AGFSKGQFQPIFDGCKIFNDLNLDAAMGALYSGKKSAYFDGATSDEINEFFELSAAKLL
FT                   SNGHGVWSGLLKAELRPKAKVVANKTRTFTSAPIDILMGAKAVVDEFNKFFYTKHLRGP
FT                   WTVGINKFNGGWDLLAKNLMVHEWFIDADGSQFDSSITPLLMNAILNIRQYFMAEDDEA
FT                   EQMLANLYTQIINTCILIEDGTIVQKFRGNNSGQPSTVVDNTMCLIIAMEYCRMRVEKD
FT                   HEHRMRILYVCNGDDLLINADTKDKDFIQQYFADYMRELELNYSFDEAYRSIEEVEYMS
FT                   HTFMKRNSMYIPKLKRERIVAILEWQRSKEPKAIQSAIIAAYVEAFGYDEFTEMIEELA
FT                   QEVSAVWPDFKLPSRQEVEDLYLTGTRTDLGEEIKECGEQYCVYESSEAATDAVLAAAN
FT                   AGTGSASSSGSTQSSQSASTASGSGSSPSGSGSGAAGGSGSGSAQTQSNNVSVMAGLDT
FT                   GGAKTDQGSGSKGTGGSFTSNPVRTGGRATDVQDQTPGLVFPAPKITTKAIYMPKTVRD
FT                   KIKPEMINNMIKYQPRAELIDNRYATTEQLNTWIKEASEGLDVTEDVFINTLLPGWVYH
FT                   CIINTTSPENRALGTWRVVNNAGKDNEQQLEFKIEPMYKAAKPSLRAIMRHFGEGARVM
FT                   IEESVRIGKPIIPRGFDKAGVLSINNIVAACDFIMRGADDTPNFVQVQNSVAVNRLRGI
FT                   QNKLFAQARLSAGTNEDNSRHDADDVRENTHSFNGVNALA"
XX
SQ   Sequence 9384 BP; 2970 A; 1892 C; 2296 G; 2226 T; 0 other;

AF057533 Length: 9384  23-NOV-2005  Type: N  Check: 8641  ..
       1  aaattaaacc aacccaaatc gatctgacaa cgaacaaaac gaactcaaag
      51  cacccacaag ctctagttca acaaagttca tcacgcagaa agcaattcgt
     101  tcattgtgag ctctcgcata gagataagca atggcaacag cgaattgttt
     151  gctcggtgac ttcggaaggc agggggtcgt cgctaacgac ccatatgtac
     201  agtgcagagc gcgcacgctg attttcctaa gcactgagga ggaggttgat
     251  gtggtggtta accaccacgg accaggaagc attttctggt caaaagaagg
     301  tatcttaaca cagacggcta agaaccttta caaagctact gcgtatggct
     351  taggctacga ccttgcagca aacgtcttcg tttgcggcaa gtgtaggtcc
     401  agctgcactc agtataggta cttcattgag gatcactttg cttgcgacaa
     451  actcgtggag aagaactgcg cgtacatcaa ggatgataag tacgtgaagg
     501  ttgtggaggc attcccaatt atgccatctt atgccacacc agggcaagaa
     551  acacgcatca tacagtggat gaacaagaca agtcaatgcc ttgctgatca
     601  ctgcatccaa cgcactcgcg agatcacttt caccaactca aaaactcagg
     651  aggaagaaac tcgcgtgaag gattgcagtt tggaagtatt ttatgatgac
     701  ttcgatgaag ctcatgctgt gattgagcac gcacatcgga aaaatccggt
     751  tcacgaatat aaggagaagc agctgcggat gacttcaaat aatatagctg
     801  cgttagtgga ccaagtgaca cggatgatgc actccaaggg caaaacagtg
     851  gaaatagttg ggagtaaagg ccataagaaa tttgccaaaa ttccactgaa
     901  gcacacaatg ggatatccaa agcgggattg ggacgcaaca aaggacatac
     951  cagaagattt cagaggcttt atcacaactt atagtggcgt catacaatac
    1001  acacgcaaag tgcaggatca cgaagtgacg cttggatgga gtggtgttct
    1051  gcttagtgag atggatgttc ctgatggcta tcaagaagat tgcgttgacg
    1101  gtctatttat tgtcatggga agatgtgcac atggacgcat tcaaaatgca
    1151  ctgaagccga aatgcacaca tggacttaga tggtatggcg accaagcagt
    1201  gaacaaagtt attccgaaat atcacgatgt gtgcaacaac aactgcgcaa
    1251  gttacctgga agccttgcca agaaaggtta gccgtgtatg gcaatcaatg
    1301  tttgacatac ataatctgag gtgcgaccaa tgtagaacag agtggaagat
    1351  gcgaacagcc tcagagcatt tgcaattgtt acagaaatcg gtggaacatt
    1401  acatgcaaac gtatccagac agcgatgtaa cactgttcaa agcattcttg
    1451  caagcactag ggccagatga agaggttgag gcacgccagc tcaaacccaa
    1501  caatacattg caacttgtag atgtgtggcg aacaatgaaa aacacaataa
    1551  acatcccgaa tagaatcatc tacatgggca tgttcacgga caattatggg
    1601  aattttgatt tctttccgaa cacatcaatg cctgaattat tcgccatgca
    1651  catgcaaccg gtgcaacata agatgctaga agatggaaca attgaaacga
    1701  attttaggtt cgttgatttg gaagggaaaa tccaaactag cattgaaagt
    1751  ttgtatccga catttgacag cacatactgg aatgaacaag cacgcagagt
    1801  tcacagaatc caaccgctag cagactgctc gatggaaatt aacggcgagt
    1851  ctaagcccat ttgtcactgg gaaggaaatg tgcctttgta caatcccatt
    1901  attcgtgcaa cgcctggaca attaccgttt ggagttacaa cgcatttgct
    1951  gagtgtaaat gacaggagtg gaagattcca ttatgtgccg aagaatgggt
    2001  attgttacat gtacatattt gcctgtgcga tgattttctg tggtaatagc
    2051  aatcgttcca cagttgacgc ctttgttcgg caagtctgcg aggatctggg
    2101  tccttggcca atgtttggtg atgtactaag acaacttgac tggatggcga
    2151  ccttttatgg atgttacgac gcattggtgc cagtcatctt ggtagaccat
    2201  acaagaaaga ccatgcacgt gccaacacca tatggtataa agcaatcagg
    2251  aatgcatacc atcagagtca acacagtgct agagttgata actctcgata
    2301  ccatggccag tggagcaatg aaagattaca aaattggcgg gttccaagag
    2351  actgttctca gtatacaagc atgcgtcaag agcagaaaag aatttgtgcg
    2401  caaaattaac aaggatgcag aatggttggt ggatatgttt attaatcctt
    2451  caacgctctt cgtgttggga ggcttaattg aagtgcacca agtcattctt
    2501  gctgatgtcg aaaattcatt cgacaaatca gcagctttac taaacttgcg
    2551  ccaaatagct ttaaagctcg gaccacactt ggaatcaaag cagcgtgtac
    2601  gtcagtacat ggagttaatg attcagcatc gggcatcagt tgaagcaata
    2651  attccctcgc aacacatgaa agctgagatg atgcaatata ttgatgcact
    2701  gcaacgctca attcttgagg agcaagtaat catagagatg gatcgagttg
    2751  gaggaaagga aaaaatgctc gtcgagcaag atctttcaca cgcagagtgt
    2801  gcgtacaacg agttcttcaa ctccattggc tacttaaact ttcatggaac
    2851  cgttttacga ctcacatatt ctggtccagg aagaaaggtt ggagaagtgc
    2901  tagagagttt aagagacaac tggttgacac gctatctccg aggaccgaag
    2951  cagccgagag actacaaagg gagttccttg aggatttgga ggaaggttac
    3001  tcacctttgc ggaaacgctt acaggtgggt attttacaac atggccgcga
    3051  acgtcttgca agttatactc ataggccttt ctaccgtttt cggagcatat
    3101  ttattaaaga agatcttaaa aatgctgcag tgggagaagg agcaagaaag
    3151  cacagaattg gttgaatacc aagggaagcg agaggaagca tggataacac
    3201  gagtaatggc tgtattgtat ataatagctt cacttttctc cgtagatttt
    3251  agttctgctt tatattcgaa tttggtgaag ttcagaacca tatttgacat
    3301  cttgaagttt aattgcgaat atcagagtgg aatttttgaa agtctgaaaa
    3351  atcaactcgg caacatccca gcgtttcatg aggtacattt gtatgaccat
    3401  gaggcaacac aagtagcagt tccaccagcg atattgacat tcgagcgatg
    3451  gttcgagact cggatcacat ctggccagca aggatatgca ccacttgatg
    3501  gtagccacgt gagcttaacg atgacaaaag acacagttgg tgagatcgca
    3551  acacaagtgc aaacgcacaa ggcaaaggag tttcttatta taggacatgt
    3601  tggatgtggg aaatctacag cttttccagc aacactctcc cggaatgggc
    3651  gtgtgatgat atgcgaacca acccgcgtgc tagtcacaaa tttgcaggat
    3701  tcaatgctag caacgagaaa tctaagcatc agtgccatga tgagaaacca
    3751  ccgggttatg acggcgtcga atataacagt aactacgtat gggtatgcac
    3801  tccactactt gtacaacaac tcacataacc tttcagaata tgattatatt
    3851  ctttttgacg aagtgcacca aacctcggca gagatgttag tgttttacaa
    3901  ctggcttaag agcacaacgt gggagggcaa gctcatcaag ttaacagcca
    3951  cgaacaacac agttaatggc gacatgcaaa cacagcaagc cctcgatgtc
    4001  aaaacgtggc cggttatgga tcacagaaca ttcatgcagg agcaaggtcg
    4051  aggaacggct cacgatgcat caactcttgg tgatgtcatc atagtcttct
    4101  taacttcgtt tcgtgaaatt gatgaatctg ctgatatttt aagcaaaaat
    4151  tcaaagattg gcgtaataaa ggcagatagt cggcacttgc gaaacaaaat
    4201  tagcttgatg gatgatgtcg aagcactccg agctgagaag aaatacattc
    4251  ttgcaactaa tattcttcaa aacggtgtga atttgcatgc agacgttgtc
    4301  gttgattttg gcttcaagat tgtaccagcc attgacagcg acaatcggat
    4351  gatcacagtc aagcgccaat tgatcaacaa atcagacagg attcagagac
    4401  taggacgagt aggccggatg aagatgggat acgcaaggaa aatcggaaat
    4451  gaaatagatg cctcattcgc tttggatgaa gtcacagcta cggaagctgc
    4501  cttgttggca tttggactcg gtgttgctcc agtgttgcag aatgtcgatc
    4551  aacacacatt cggaaaaata acagcagagc aagttcgaac agctgcgcgc
    4601  tttgaaatgc aattgtcgta tatggtgtgg atgattaaca gagatggcac
    4651  tatggccaca cggttatatg aacaattcaa atcattgctt ttaacaccag
    4701  ggaacacgag tttggctccg tattacgaga cactcgttga cactcacaga
    4751  ttcagaacta ttggacaata cgcaactctt ggatacatgc gcacagacga
    4801  aaagcaccat ttggtattac catttcatca taatgacgtg agcgttgaat
    4851  ttgccgaaag gattggcgaa gcctatatgg cctctcaagt cccgacatca
    4901  atcaagttgc gcgtacctgc tgtaaatcat agagaagtgg cgatgaagat
    4951  gtcagcaaat cctgaagatg tgggaaccat attgtatatg gttgagcaag
    5001  cgctaataag tgaaaagacg aaactggaga atttaaccca ggcattccag
    5051  cagcaacaat caacatattg cagcgtgctc atccctaatt ttaatgttgc
    5101  tggtcggcta acacaggcaa tggatcgcat aagaaagaat gtttctgtgc
    5151  tgcaacacca gaaaacagct ctcgaaaagg cggcagtgac ttacgactac
    5201  acgaagttag ttgagctcct tgatgaaaat ccaagcatag cttcccatgt
    5251  gtcataccag gctgggccag caaaattcat tgatgaattc atattggaga
    5301  agcgcgatta tgggtggcta ccatatcttg cagtaggaac tgcgtgtgca
    5351  attgctggca caacacttgt aatgatgtac taccgtcgca tgaagcgtag
    5401  tgtcaagttc gagggcaaag cagcacgcaa caggagtgca aaacgacaat
    5451  cagcaagaga ccaaaagatg gagcgtggta acgaatacac atactacgat
    5501  gctggtgaca ccttgtataa tggagttcaa gagaatatga atcatgcacc
    5551  agactggacc gatcggatta agaagaagac tcatgcatac gctatgcaat
    5601  ttggtaggga agtaccaaag actgaaacac agcgatcctc acaatactgg
    5651  cacttctacg gttttgatcc aaagatgtat gactcagtcg aattcaagga
    5701  catagcagca aacttctcag tgcaccagga tgcaaaggca atggatttgc
    5751  agaaagcctt cacagaaatg gtggaaaatc gttgggatga tgaagacttc
    5801  ttcgacgaga agataccaaa gcgagttttg gccatcttca ggaaaggaga
    5851  caaggttcgt gaagttgcat tggcacctca caagccaaac caagtcaaca
    5901  agcgtgggct acctgtcgga catgctgatc acagaggaga gtggagacaa
    5951  acacagcctt catttgaaaa agaagtgtcg tacgagaaca aatcaacttt
    6001  cgaaggtgca cgttcacttg atcatatcca tcagaatcaa gtcatcctcg
    6051  ttgaagacaa tcagcagtta aatgggctaa tagttgggaa catactcttg
    6101  gcgccatatc atttcacacg aggtatgagg aacagagagg agaaggagac
    6151  acgcatgttg acacagtttg gaacgtacaa tcttggaaaa cttaccaaca
    6201  agcatgtcac aaaatttaca atgatggatc tggtagcatt aaccttgcct
    6251  ccaacatttc aagcaagacg gaaactcaaa tgtttcagac caccaaggga
    6301  aggagagcga gcaatgttgg tgaccatgca gtacgagaaa gcaggatggg
    6351  ttgccaagca atcagcagaa acaacaatca caccattcgg tgatcgacat
    6401  gatggtttgt ggaagcatag aatttcaaca ggaccaggtg actgtggaag
    6451  cgccatagta gcagtagcag acctaaaagt tgtgggattc cataaccttg
    6501  gagggaaagg tgagaattat ttcacaccga taactattga ggtcatggat
    6551  ttcttagctg aaaagtctgt gacaccgctt gtgccatgga agttctcaga
    6601  cgagcaagtt gacttatgtg gtttaattgc ggccaatgga gcagacaaat
    6651  acccattcac caaaacaata agcgacttgg ttagttggca aagtctccaa
    6701  atgacgaaat actgtgggga gaacttcaag gctatcgctt atgctccaaa
    6751  ccgaatgtcg aaaaggcatg tcataacagg aaagaggcct gaattcatta
    6801  aatttctaga ttcccacccg aagtggaatg caacggtaac acctttctta
    6851  aacgggtttc aaccatcagt tttgacacat gaagcatatt acaaggatgt
    6901  gttgaagtat aacaaagaca taattgttgg agggactgat gaagtgtgtt
    6951  ttgcgaaggc agtggtcgca accattggga ttctagaaat agccggattt
    7001  tcaaagggac aatttcaacc aatctttgac ggatgtaaaa ttttcaatga
    7051  cttgaatttg gatgccgcaa tgggagcttt gtactcaggg aagaaatcag
    7101  catactttga cggagcaaca agcgacgaga tcaatgaatt ctttgaactg
    7151  agtgcagcga agctactcag taacggacat ggagtatggt ctggtttact
    7201  caaagctgag ttgagaccga aggcaaaggt cgtggcgaac aaaacgcgaa
    7251  cattcacatc agcaccaatt gatatactca tgggtgccaa agctgtggtt
    7301  gatgagttca acaaattctt ctacacaaag catttgcgcg gaccatggac
    7351  tgtcggaatc aataagttca acggaggttg ggatttgttg gccaaaaatt
    7401  taatggtgca cgagtggttc attgacgctg atggttcgca attcgacagt
    7451  tcaatcactc cacttctcat gaatgcaatt cttaacatac ggcaatactt
    7501  catggcagaa gatgatgaag ctgaacaaat gctggcaaat ttgtatacgc
    7551  agattataaa cacatgcatt ttaattgaag atggaacgat tgtgcagaag
    7601  tttcgaggta ataacagtgg ccaaccaagc acagttgttg acaacacgat
    7651  gtgtttaatc atagcaatgg agtattgcag aatgcgcgtc gaaaaggatc
    7701  atgaacatag aatgaggata ctgtacgtgt gcaacggaga tgatttgctt
    7751  attaatgccg acacaaagga caaagacttc atacagcagt attttgccga
    7801  ttacatgcgc gaactggagc tgaattactc atttgacgag gcttaccgta
    7851  gtatcgagga ggtggaatac atgtcacata catttatgaa gcgaaattcg
    7901  atgtacattc caaagttgaa acgcgaacgt attgtggcaa ttctggagtg
    7951  gcagaggagc aaggaaccga aggctattca gagcgctatt attgcagcat
    8001  acgtggaagc tttcggttat gatgaattca cggagatgat tgaagaactt
    8051  gcgcaggaag tttcagcggt gtggccggat ttcaagttgc cctcacgaca
    8101  agaggttgag gatttgtact tgactgggac ccgaacggat ttaggagaag
    8151  agattaagga atgtggagag caatactgcg tgtacgaatc gagtgaggcc
    8201  gcaaccgacg ctgtcttggc ggcagcaaat gcaggaactg gtagtgcatc
    8251  gagtagtgga agcactcagt caagtcagag cgcaagtact gctagcggat
    8301  cagggagttc accatcagga tcaggttctg gagcagcggg tggatcaggt
    8351  tctggatcag cacaaacaca atctaataac gtatctgtca tggctggcct
    8401  cgacacggga ggagctaaga cagatcaagg atcaggatca aaagggacgg
    8451  gtggttcatt cacatcgaat cccgtgcgaa ctggaggccg agcaacggat
    8501  gtgcaagatc agacaccagg tttagtgttt ccagcaccaa agatcacaac
    8551  aaaggccata tacatgccaa aaactgtacg cgacaagata aaacctgaaa
    8601  tgataaataa catgatcaaa taccaaccgc gtgctgaact tatcgacaac
    8651  agatatgcca caactgaaca actcaacacc tggataaaag aggcatctga
    8701  agggcttgac gtgacagagg atgttttcat aaacacctta cttccaggat
    8751  gggtctacca ctgcataatc aacacaacga gcccagagaa cagagcacta
    8801  ggaacttggc gtgttgtgaa caatgcaggc aaggacaatg agcagcaact
    8851  cgagtttaag attgaaccga tgtacaaagc tgcgaagcca tcacttcgag
    8901  ccattatgcg ccactttggt gagggagctc gagtgatgat cgaggagagt
    8951  gttcgaattg gaaaacctat cataccaagg ggcttcgaca aggccggtgt
    9001  gctaagcatc aacaatattg tggcagcgtg tgatttcatc atgcgcggtg
    9051  cagatgacac accaaatttt gtgcaagtgc agaacagcgt tgcagtaaac
    9101  aggctacgcg gaatacagaa caagctgttt gcacaggcac gactgagtgc
    9151  gggtactaat gaggacaact cacgtcatga tgcagatgat gtgagggaga
    9201  acacgcacag tttcaatggt gtaaacgctc ttgcgtgagc acagtagaaa
    9251  ctacaaatcc acgagtacca ggatttgagc gaaataacgc tgcgtttcgt
    9301  taacccttcg ttgttactag gtgtgtactt ctccacgaga ggcgtgcatt
    9351  cttggtagct atgtgtgggt tagggcgacg ctac