!!NA_SEQUENCE 1.0
ID   AF060855   standard; RNA; VRL; 1454 BP.
XX
AC   AF060855;
XX
SV   AF060855.1
XX
DT   06-OCT-1999 (Rel. 61, Created)
DT   06-OCT-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Citrus ringspot virus coat protein gene, complete cds.
XX
KW   .
XX
OS   citrus ringspot virus
OC   Viruses; ssRNA negative-strand viruses; Ophiovirus.
XX
RN   [1]
RP   1-1454
RA   Sanchez de la Torre M.E., Garcia M.L., Grau O.;
RT   ;
RL   Submitted (21-APR-1998) to the EMBL/GenBank/DDBJ databases.
RL   Instituto de Bioquimica y Biologia Molecular, Facultad de Ciencias Exactas,
RL   Universidad Nacional de La Plata, Calles 47 y 115, La Plata, Bs. As. 1900,
RL   Argentina
XX
DR   SPTREMBL; Q9QMA7; Q9QMA7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1454
FT                   /db_xref="taxon:88130"
FT                   /note="top component"
FT                   /organism="citrus ringspot virus"
FT                   /strain="citrus ringspot virus-4"
FT   CDS             66. .1385
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QMA7"
FT                   /product="coat protein"
FT                   /protein_id="AAF00018.1"
FT                   /translation="MSIPIKVSQLIDAKAKWESDKENCPAEITTLLKTYGVLRETGALS
FT                   SKSTAYLAGLSKDKRVILTDEGLAEFKNVENPHDQGEKPTFSLASSSNIKITDIEVIKQ
FT                   KMEQETFQIDQLKLKEQIENFIKTVTLDDESYTEGEIVIKHFGNPDAELNMLVTAGTKI
FT                   LDGLVYVSMKGDTKSLNLFKIEQVDGVCDSDIVKNIRVAKRAIQAAFVLVFTQGSLPGK
FT                   ADDKRKVPEFVKSKLYDGDVSLSQISDELSHAPTKKFPARVFLKIDIDNLPSAVCSRCK
FT                   LNIAGNRSVRYASFASSFQTKQKLSPAVGATPESLMPLLETNQKIEKAIAIRDFLKTME
FT                   GQWKNQKRLHPLSDEKPTIKNFTLKLTCAIIYSLTPDGRTDMAERIISDNNKGFQNDRN
FT                   FFGDGEGPIRTWSVLTKPEADFSNITVDGLKGIFGVAATM"
XX
SQ   Sequence 1454 BP; 490 A; 257 C; 321 G; 386 T; 0 other;

AF060855  Length: 1454  December 21, 2001 14:51  Type: N  Check: 5626  ..
       1  gatacttttt tttgtggaaa aagcatcatt ttgtcaagtt ttcaactaaa
      51  tactaagaac tgaaaatgtc gattcctatt aaagtgtcac agctgattga
     101  tgccaaagca aaatgggaaa gtgacaaaga gaattgccct gctgaaataa
     151  caactctcct gaaaacatat ggagttctga gagagactgg agcattaagc
     201  tcaaaaagca cagcttatct ggctggattg tcaaaagaca agagagtaat
     251  cctaactgat gaaggattag cagagttcaa gaatgttgaa aatcctcatg
     301  atcagggaga gaagccaaca ttttcattgg cctcatccag caacatcaag
     351  ataactgata tagaggttat caaacagaaa atggagcagg agacgtttca
     401  aattgatcaa ctgaagctca aggaacaaat tgagaatttt atcaaaacag
     451  tgactcttga tgatgaatct tacactgagg gtgagatagt catcaagcat
     501  tttggtaacc cagatgctga gctcaatatg cttgtgactg ctggaacaaa
     551  aatactggat ggtctagtat atgtttcaat gaaaggagac actaaatcac
     601  tcaacttgtt caagatagag caagttgatg gggtctgtga ttctgatatt
     651  gtcaaaaata tcagggtagc caagagagca attcaagctg cttttgtact
     701  tgttttcaca caagggtcgc ttcctggaaa agctgatgac aaaaggaaag
     751  ttcctgaatt tgtcaagtca aaactgtatg atggtgacgt gagtttgtca
     801  caaatcagtg atgagttgag ccatgctcca accaagaaat tccctgcaag
     851  ggtatttctc aagattgata ttgataactt gccaagtgct gtttgctcca
     901  gatgcaaact gaatattgct ggaaatcgat ctgtgaggta tgccagcttt
     951  gcaagcagct ttcaaacaaa gcaaaagttg tcccctgctg ttggtgcaac
    1001  tcctgagtcc ttgatgcctt tactagaaac aaaccagaag attgagaagg
    1051  caattgcaat tagggatttc ctaaaaacga tggaaggtca atggaaaaac
    1101  cagaagcgac tccacccctt atctgatgag aaaccgacaa tcaagaactt
    1151  caccttaaag ctaacatgcg ctataatcta cagcctcact ccagatggaa
    1201  gaactgacat ggcagagagg ataatatccg acaataataa ggggtttcag
    1251  aatgatagga acttttttgg tgatggtgaa gggccaataa ggacatggag
    1301  tgtgttgaca aaaccagagg cagatttcag caatataaca gtcgacggtc
    1351  tcaaaggtat ctttggggtg gctgcgacta tgtaattcga ttctttatta
    1401  atgctgtgtg cttgcatgtt atcgttttaa ataaacaaaa gttcccaaat
    1451  tcgg