!!NA_SEQUENCE 1.0
ID   AF218572   standard; genomic RNA; VRL; 1644 BP.
XX
AC   AF218572;
XX
SV   AF218572.1
XX
DT   05-JUN-2002 (Rel. 72, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 3)
XX
DE   Citrus psorosis virus RNA 2 segment, partial sequence.
XX
KW   .
XX
OS   Citrus psorosis virus
OC   Viruses; ssRNA negative-strand viruses; Ophiovirus.
XX
RN   [1]
RP   1-1644
RX   MEDLINE; 22070231.
RX   PUBMED; 12075099.
RA   De La Torre M.E., Lopez C., Grau O., Garcia M.L.;
RT   "RNA 2 of Citrus psorosis virus is of negative polarity and has a single
RT   open reading frame in its complementary strand";
RL   J. Gen. Virol. 83(Pt 7):1777-1781(2002).
XX
RN   [2]
RP   1-1644
RA   Sanchez de la Torre M.E., Lopez C., Grau O., Garcia M.L.;
RT   ;
RL   Submitted (22-DEC-1999) to the EMBL/GenBank/DDBJ databases.
RL   IBBM - Fac. Ciencias Exactas, Calles 47 y 115, 1900 La Plata, Buenos Aires,
RL   Argentina
XX
DR   SPTREMBL; Q8JVF3; Q8JVF3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1644
FT                   /db_xref="taxon:73561"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus psorosis virus"
FT                   /segment="RNA 2"
FT   CDS             47. .1477
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q8JVF3"
FT                   /product="unknown"
FT                   /protein_id="AAM47152.1"
FT                   /translation="MSMASFKSASKRITGNENVTRISANSAINSIVKKGELNVISLKDG
FT                   NTADLEGINDALLDYRRILKNEIKTAVSPITMKLKKDEHKKKLKLGTLKSITDKLRKLG
FT                   GESSHPFIQFYKVQCMYIPLFSRVDGDNGEITVSLVDDGKEAAGQDPVIQSITFDASQM
FT                   AMVELSMNFFVEKRDMDFIGIHISAGNVPVQDRAYGSINLAFFTNEQSVPMMQEEKKSS
FT                   YLMIDAVNRPKDVTKSSVFKSIGDRVSDEINQKRDEYKKKMIENERIRRREGKGVKIET
FT                   ETNGSSSSDAETLLEEARKSVSINLSNFLADQRRAPPPPQLEKRTFQWPCGVKMLTMMD
FT                   TGSSSHYFFSRSINPTSIERNFGGVAQLEVERAKLTFETFGNKFLLKDVFMFSDQTLGD
FT                   NILSYTLLKEEGHIDGMRTAGDDVLLEKDGEVVMILDSRDEGRMWIKDDVWAEVTEHGS
FT                   KSAREYCMKIERSEIKIE"
XX
SQ   Sequence 1644 BP; 557 A; 248 C; 401 G; 438 T; 0 other;

AF218572  Length: 1644  September 11, 2003 13:45  Type: N  Check: 5526  ..
       1  gatacttttt tttgtgatta aagcatcacg ttattaggtt aacacaatgt
      51  caatggcaag ctttaagtct gcttcaaagc gcataactgg aaatgaaaac
     101  gtgacaagga tatcagcaaa ttcagcaatc aattccattg tgaaaaaagg
     151  agaattgaat gtaatctctt tgaaggatgg aaacactgct gatttggaag
     201  gcattaatga tgccttgttg gattatagaa gaatcttgaa gaatgaaata
     251  aaaactgcag tgtcgccaat caccatgaaa ctcaaaaagg atgagcacaa
     301  aaagaagtta aagctgggta cactaaagtc cataaccgac aaactgagga
     351  agcttggagg tgaaagtagt catcctttta tacaatttta taaagtacag
     401  tgcatgtaca tacccctgtt ttccagggta gacggtgaca atggagaaat
     451  cactgtaagc ttggttgatg atggaaaaga agctgctgga caagatccag
     501  tcattcagag catcactttt gatgctagtc aaatggcaat ggtggaattg
     551  agtatgaact tttttgttga aaagagagac atggatttta ttgggatcca
     601  tatcagtgct ggaaatgtgc ctgtgcaaga cagagcttat ggctcaatta
     651  atcttgcttt tttcacaaat gaacaaagtg ttccgatgat gcaggaagaa
     701  aagaagagct cttatctgat gattgatgca gtgaatagac ccaaggacgt
     751  gacgaagtcc tcggtcttca aaagtatcgg tgatagagtg tctgatgaga
     801  taaaccaaaa aagggatgaa tataaaaaga agatgatcga gaatgagaga
     851  ataaggagga gggaagggaa gggtgtgaaa attgagacag aaacaaatgg
     901  atcaagctca agtgacgctg aaacactgtt agaggaggct agaaaatctg
     951  tctcaatcaa cctcagcaat tttttagctg atcagagaag ggcacctcca
    1001  ccaccacagt tagaaaagag aacatttcag tggccatgtg gagtaaagat
    1051  gttgacaatg atggacactg gttcatccag tcattatttc ttttctagga
    1101  gtataaatcc aacatcaatt gaaagaaatt ttggaggagt tgctcaactt
    1151  gaagttgaaa gagcaaaact cacctttgag acgtttggaa acaaatttct
    1201  cctaaaagat gtttttatgt tctctgatca aacccttggg gacaatattt
    1251  tgtcttacac actgttgaag gaggagggcc atattgatgg catgaggaca
    1301  gctggggacg atgttctcct agaaaaggat ggtgaggtgg tcatgatact
    1351  tgacagcagg gatgaaggaa ggatgtggat aaaagatgat gtgtgggcgg
    1401  aggtgactga gcatggatct aaaagtgcaa gggagtattg tatgaagatc
    1451  gaaaggagtg agatcaaaat tgagtgatct catgtggtaa tgtcttatct
    1501  tatatatgat atctagattg cgatgatcat gtttcgtttt aaataaacaa
    1551  gtcttttgac gatccgaaag tctgtcatac tttgaggtca aagcattgtg
    1601  cccctctaag cttatcaggc gtggaaatgt caccaggatg acac