!!NA_SEQUENCE 1.0
ID   AF285169   standard; RNA; VRL; 9384 BP.
XX
AC   AF285169;
XX
SV   AF285169.1
XX
DT   02-NOV-2000 (Rel. 65, Created)
DT   12-APR-2001 (Rel. 67, Last updated, Version 2)
XX
DE   Wheat streak mosaic virus type strain complete genome.
XX
KW   .
XX
OS   Wheat streak mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Tritimovirus.
XX
RN   [1]
RP   1-9384
RA   Choi I.-R., Hall J.S., Henry M., Zhang L., Hein G.L., French R.,
RA   Stenger D.C.;
RT   "Contributions of genetic drift and negative selection on the evolution of
RT   three strains of wheat streak mosaic tritimovirus";
RL   Arch. Virol. 146(3):619-628(2001).
XX
RN   [2]
RP   1-9384
RA   Choi I., Hall J.S., Henry M., Zhang L., Hein G.L., French R., Stenger D.C.;
RT   ;
RL   Submitted (06-JUL-2000) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS, University of Nebraska, 344 Keim Hall, Lincoln, NE 68583, USA
XX
DR   SPTREMBL; Q9E161; Q9E161.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .9384
FT                   /db_xref="taxon:31741"
FT                   /organism="Wheat streak mosaic virus"
FT                   /strain="type"
FT   CDS             131. .9238
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9E161"
FT                   /product="polyprotein"
FT                   /protein_id="AAG28731.1"
FT                   /translation="MATANCLLGDFGRQGVVANDPYVQCRARTLIFLSTEEEVDVVVNH
FT                   HGPGSIFWSKEGILTQTAKNLYKATAYGLGYDLAANVFVCGKCRSSCTQYRYFIEDHFA
FT                   CDKLVEKNCAYIKNDKYVKVVEAFPIMPSYATPGQETRSIQWMNKTSHCLADHCIQRAR
FT                   EITFTNSKTQEEETRVKDCSMEVFYDDFDEAHAVIEHAHRKNPVHEYKEKQLRMTSNNI
FT                   AALVDQVTRMMHSKGKTVEIVGSKGHKKFAKIPLKHTMGYPKRDWDASKDIPEDLRGFI
FT                   TTYSGVIQYTRKVQDHEVTLGWSGVLLSEMDVPDGYQEDCVDGLFIVMGRCAHGRIQNA
FT                   LKPKCTHGFRWYGDQAVNKAIPKYHDVCNNNCASYLEALPRKVSRVWQSMFDIHNLRCD
FT                   QCRTEWKMRTASEHLQLLQKSVEYYMQTYPDSDVTLFKAFLQALGPDEEVEARQLKPNN
FT                   TLQLVDVWRTMKNTINIPNRIIYMGMFTDNYGNFDFFPNTSMPELFAMHMQPVQHKMLE
FT                   DGTIETNFRFVDLEGKIQTSIESLYPTFDSTYWNEQARRVHRIQPLADCLMEINGESKP
FT                   ICHWEGNVPLYNPIIRATPGQLPFGVITHLLSVNDRSGRFHYVPKNGYCYMYIFACAMI
FT                   FCGNSNRSTVDAFVRQVCEDLGPWPTFGDVLRQLDWMATFYGCYDALVPVILVDHTRKT
FT                   MHVPTPYGIKQSGMHTIRVNTVLELITLDTMASGAMKDYKIGGFQETVLSIQACVKSRK
FT                   EFVRKINKDAEWLVDMFINPSTLFVLGGLIEVHQVILADVENSFDKSAALLNLRQIALK
FT                   LGPHLESKQRVRQYMELMIQHRASVEAIIPSQHMKAEMMQYIDALQRSILEEQVIIEMD
FT                   RVGGKEKMLVEQDLSHAECAYNEFFNSIGYLNFHGTVLRLTYSGPGRKVGEVLESLRDN
FT                   WLTRYLRGPKQPRDYKGSSLRIWRKVTHLCGNAYRWVFYNMAANVLQVILIGLSTVFGA
FT                   YLLKKILKMLQWEKEQESTELVEYQGKREEAWITRVMAVLYIIASLFSVDFSSALYSNL
FT                   VKFRTIFDILKFSCEYQSGIFESLKNQLGNIPAFHEVHLYDHEATQVAVPPAILTFERW
FT                   FETRITSGQQGYAPLDGSHVSLTMTKDTVGEIATQVQAHKAKEFLIIGHVGCGKSTAFP
FT                   ATLSRNGRVMICEPTRVLVTNLQDSMLATKNLSISAMMRNHRVMTASNITVTTYGYALH
FT                   YLYNNSHNLSEYDYILFDEVHQTSAEMLVFYNWLKSTTWDGKLIKLTATNNTVNGDMQT
FT                   QQALDVKTWPVMDHRTFMQEQGRGTAHDASTLGDVIIVFLTSFREIDESADILSKNSKI
FT                   GVIKADSRHLRNKVSLMDDVEALRAEKKYILATNILQNGVNLHADVVVDFGFKIVPAID
FT                   SDNRMITVKRQLINKSDRIQRLGRVGRMKMGYARKIGNEIDASFALDEVTATEAALLAF
FT                   GLGVAPVLQNVDQHTFGKITAEQVRTAARFEMQLSYMVWMINRDGTMATRLYEQFKSLL
FT                   LTPGNTSLAPYYETLVDTHRFRTIGQYATLGYMRTDEKHHLVLPFHHNDVSVEFAERIG
FT                   EAYIASQVPTSIKLRVPAVNHREVAMKMSANPEDVGTILYMVEQALISEKTKLENLTQA
FT                   FQQQQSTYCSVLIPNFNVAGRLTQAMDRIRKNVSVLQHQKTALEKAAVTYDYTKLVELL
FT                   DENPSIASHVSYQAGPAKFIDEFILEKRDYGWLPYLAVGTACAIAGTTLVMMYYRRMKR
FT                   SVKFEGKAARNSSAKRQSARDQKMERGNEYTYYDAGDTLYNGVQENMNHAPDWTDRIKK
FT                   KTHAYAMQFGREVPKTEAQRSSQYWHFYGFDPKMYDSVEFKDISANFSVHQDAKAMDLQ
FT                   KAFTEMVENRWDDEDFFDEKIPKRVLAIFRKGDKVREVALAPHKPNQVNKRGLPVGHAD
FT                   HRGEWRQTQPSFEKEVSYENKSTFEGARSLDHIHQNQVILVEDNQQLNGLIVGNILLAP
FT                   YHFTRGMRNREEKETRMLTQFGTYNLGKLTNKHVTKFTMMDLVALTLPPTFQARRKLKC
FT                   FRPPREGERAMLVTMQYEKAGWVAKQSAETTITPFGDRHDGLWKHRISTGPGDCGSAIV
FT                   AVADLKVVGFHNLGGKGENYFTPITIEVMDFLAEKSVTPLVPWKFSDEQVDLCGLIATN
FT                   GADKYPFTKTISDLVSWQSLQMTKYCGENFKAIAYAPNRMSKRHVITGKRPEFIKFLDS
FT                   HPKWNAVVTPFLNEFQPSVLTHEAYYKDVLKYNKDIIVGGTDEVCFAKAVVATIGILEI
FT                   AGFSKGQFQPIFDGCKIFNDLNLDAAMGALYSGKKSAYFDGATSDEINEFFELSAAKLL
FT                   SNGHGVWSGLLKAELRPKAKVVANKTRTFTSAPIDILMGAKAVVDEFNKFFYTKHLRGP
FT                   WTVGINKFNGGWDLLAKNLMVYEWFIDADGSQFDSSITPLLMNAILNIRQYFMAEDVEA
FT                   EQMLANLYTQIINTCILIEDGTIVQKFRGNNSGQPSTVVDNTMCLIIAMEYCRMRVEKD
FT                   HGHRMRILYVCNGDDLLINADTKDKDFIQQYFADYMRELELNYSFDEAYRSIEEVEYMS
FT                   HTFMKRNSMYIPKLKRERIVAILEWQRSKEPKAIQSAIIAAYVEAFGYDEFTEMIEELA
FT                   QEVSAVWPDFKLPSRQEVEDLYLTGTRTDLGEEIKECGEQYCVYESSEAATDAVLAAAN
FT                   AGTGSEPSSGSTQSSLSASTASGSGSSPSGSGSGAVGESGSGSAQTQSNNVSVMAGLDT
FT                   GGTKTGQGSGSKGTSGSFVSNPVRTGGRATDVQDQTPGLVFPAPKITTKAIYMPKTVRD
FT                   KIKPEMINNMIKYQPRAELIDNRYATTEQLNTWIEEASEGLDVTEEVFINTLLPGWVYH
FT                   CIINTTSPENRALGTWRVVNNAGKDNEQQLEFKIEPMYKAAKPSLRAIMRHFGEGARVM
FT                   IEESVRIGKPIIPRGFDKAGVLSINNIVAACDFIMRGADDTPNFVQVQNSVAVNRLRGI
FT                   QNKLFAQARLSAGTNEDNSRHDADDVRENTHSFNGVNALA"
XX
SQ   Sequence 9384 BP; 2970 A; 1898 C; 2294 G; 2222 T; 0 other;

AF285169  Length: 9384  December 21, 2001 14:59  Type: N  Check: 8864  ..
       1  aaattaaacc aacccaaatc gatctgacaa cgaacaaaac gaactcaaag
      51  cactcacaag ctcaagttca acaaagttca tcacgcagaa agcaattcgt
     101  tcattgtgag ctctcgcata gagataagca atggcaacag cgaattgttt
     151  gctcggtgac ttcggaaggc agggggtcgt cgctaacgac ccatacgtac
     201  agtgcagagc gcgcacgctg attttcctaa gcactgaaga ggaggttgat
     251  gtggtggtta accaccacgg accaggaagc attttctggt caaaagaagg
     301  cattttaaca cagacggcta agaaccttta caaagctact gcgtatggcc
     351  taggctacga ccttgcagca aacgtcttcg tttgcggcaa gtgtaggtcc
     401  agctgcactc agtataggta cttcattgag gatcactttg cctgcgacaa
     451  actcgtggag aagaactgcg cgtacatcaa gaatgataag tacgtgaagg
     501  ttgtggaggc attcccaatt atgccatctt atgccacacc agggcaagaa
     551  acacgcagca tacagtggat gaacaagaca agtcattgcc ttgctgatca
     601  ctgcatccaa cgcgctcgcg agatcacttt caccaactca aaaactcaag
     651  aggaagaaac tcgcgtgaag gattgcagta tggaagtgtt ttatgatgac
     701  ttcgacgaag ctcatgcagt gattgagcac gcacatcgta agaatccggt
     751  tcacgaatat aaagagaagc agttacggat gacttcaaat aacatagctg
     801  cgttagtgga ccaagtgaca cggatgatgc actccaaggg caaaacagtg
     851  gaaatagttg ggagtaaagg ccataagaaa tttgccaaga ttccactgaa
     901  gcacacaatg ggatatccaa agcgggattg ggacgcatca aaggacatac
     951  cagaagatct cagaggcttt atcacaactt atagtggcgt catacaatac
    1001  acacgcaaag tgcaggatca tgaagtgacg cttggatgga gtggtgttct
    1051  tcttagtgag atggatgttc ctgatggcta tcaagaagat tgcgttgacg
    1101  gtctatttat tgtcatggga agatgcgcac atggacgcat tcaaaacgca
    1151  ctgaagccaa aatgcacaca tggatttaga tggtatggcg accaagcagt
    1201  gaacaaagct attccgaaat accacgatgt gtgcaacaac aactgcgcaa
    1251  gttacctgga agccttgcca agaaaggtta gccgtgtatg gcaatcaatg
    1301  tttgacatac ataatctgag gtgcgaccaa tgtagaacag agtggaagat
    1351  gcggacagct tcagagcatt tgcaattgtt acagaaatct gtggaatatt
    1401  acatgcaaac gtatccagac agcgatgtaa cactgttcaa agcattcttg
    1451  caagcactag ggccagatga agaggttgag gcacgccagc tcaaacccaa
    1501  caatacattg caacttgtag atgtgtggcg aacaatgaaa aacacaataa
    1551  acatcccgaa taggatcatc tacatgggca tgttcacgga caattatgga
    1601  aattttgatt tctttccgaa cacatcaatg ccggaattat tcgccatgca
    1651  catgcaaccg gtgcaacata agatgctaga agatggaaca attgaaacga
    1701  attttaggtt cgttgatttg gaggggaaaa tccaaactag cattgaaagt
    1751  ttgtatccga catttgacag cacatactgg aatgaacagg cacgcagagt
    1801  tcacagaatc caaccgctag cagactgctt gatggaaatc aacggcgagt
    1851  ctaagcccat ttgtcactgg gaaggaaatg tgcctttgta caatcccatt
    1901  attcgtgcaa cgcctggaca attaccgttt ggagttataa cgcatttgct
    1951  gagtgtaaat gacaggagtg gaagattcca ttatgtgccg aagaatgggt
    2001  attgttacat gtacatattt gcctgtgcga tgattttctg tggtaatagc
    2051  aatcgttcca cagttgacgc ctttgttcgg caagtttgcg aggatctggg
    2101  tccttggcca acatttggtg atgtgctaag acaacttgat tggatggcga
    2151  ccttttatgg atgttacgac gcattggtgc cagtaatttt ggtagaccac
    2201  acaagaaaga ccatgcacgt gccaacacca tatggtataa agcaatcagg
    2251  aatgcatacc atcagagtca acacagtgct agagttgata actctcgata
    2301  ccatggccag tggagcaatg aaagattaca aaattggcgg gttccaagag
    2351  acagttctta gcatacaagc atgcgtcaag agcagaaaag aatttgtgcg
    2401  caaaatcaac aaggatgcag aatggttggt ggacatgttt attaatcctt
    2451  caacgctctt cgtgttagga ggcttaattg aagtgcacca agtcattctt
    2501  gctgatgtcg agaattcatt cgacaaatca gcagctttac taaacttgcg
    2551  ccaaatagct ttaaagctcg gaccacattt ggaatcaaag cagcgcgtac
    2601  gtcagtacat ggagttaatg attcagcatc gagcatcagt tgaagcaata
    2651  atcccctcgc aacacatgaa agctgagatg atgcaataca ttgatgcact
    2701  gcaacgctca attcttgagg agcaagtaat catagagatg gatcgagttg
    2751  gaggaaagga aaaaatgctc gtcgagcaag atctttcaca cgcagagtgt
    2801  gcgtacaacg agttcttcaa ctccattggc tatttaaact ttcatggaac
    2851  cgttttacga ctcacatatt ctggtccagg aagaaaggtt ggagaagtgc
    2901  tagagagttt aagagacaac tggttgacac gctatctccg aggaccgaag
    2951  cagccgagag actacaaagg gagttccttg aggatttgga ggaaggttac
    3001  tcacctttgc ggaaacgctt acaggtgggt attttacaac atggccgcga
    3051  acgtcttgca agttatactc ataggccttt ctaccgtttt cggagcatat
    3101  ttattaaaga agatcttaaa aatgctgcag tgggagaagg agcaagaaag
    3151  caccgaattg gttgaatacc aagggaagcg agaggaagca tggataaccc
    3201  gagtaatggc tgtattgtat ataatagctt cacttttctc cgtagatttt
    3251  agttctgctt tatattcgaa tttggtgaag ttcagaacca tatttgacat
    3301  cttgaagttt agttgcgagt atcagagtgg aatttttgaa agtttgaaaa
    3351  atcaactcgg caacatccca gcgtttcatg aggtacattt gtatgaccat
    3401  gaggcaacac aagtagcagt cccaccagct atattgacat tcgagcgatg
    3451  gttcgagact cggatcacat ctggccagca aggatatgcg ccacttgatg
    3501  gtagccacgt gagcttaacg atgacaaaag acacagttgg tgagatcgca
    3551  acacaagttc aagcgcacaa ggcaaaggag tttctcatta taggacatgt
    3601  tggatgtgga aaatctacag cttttccagc aacactctcc aggaatgggc
    3651  gtgtgatgat atgtgaacca acccgcgtgc tagtcacaaa tttgcaggat
    3701  tcaatgctag caacgaagaa tctaagcatc agtgccatga tgagaaacca
    3751  ccgggttatg acggcgtcga acataacagt aactacgtat gggtatgcac
    3801  tccactactt gtacaacaac tcacataacc tttcagaata tgattatatt
    3851  cttttcgacg aagtgcacca aacctcggca gagatgctag tgttttacaa
    3901  ctggcttaag agcacaacgt gggatggcaa gctcatcaag ttaacagcca
    3951  cgaacaacac agttaatggc gacatgcaaa cacagcaagc ccttgatgtc
    4001  aaaacgtggc cggttatgga tcacagaaca ttcatgcagg agcaaggtcg
    4051  aggaacggct catgatgcat caactcttgg tgacgtcatc atagtctttt
    4101  taacttcgtt tcgtgaaatt gatgaatctg ctgatatttt aagcaaaaat
    4151  tcaaaaattg gcgtaataaa ggcagatagt cggcacttgc gaaacaaagt
    4201  tagcttgatg gatgatgttg aagcactccg agctgagaag aaatacattc
    4251  ttgcaactaa tattcttcaa aacggtgtga atttgcatgc agacgttgtc
    4301  gttgattttg gcttcaagat tgtaccagcc attgacagcg acaatcggat
    4351  gatcacagtc aagcgccaat tgatcaacaa atcagatagg attcagagac
    4401  taggacgagt gggccggatg aagatgggat acgcaaggaa aatcggaaat
    4451  gaaatagatg cttcattcgc tttggatgaa gtcacagcta cggaagctgc
    4501  cttgttggca tttggactcg gtgttgctcc agtgttgcag aatgttgacc
    4551  aacacacatt cggaaaaata acagcagagc aagttcgaac agctgcacgc
    4601  tttgaaatgc aattgtcgta tatggtgtgg atgatcaaca gagatggcac
    4651  tatggccaca cggttatatg aacaattcaa atcattgctt ttaacaccag
    4701  ggaacacgag tttggccccg tattatgaga cactcgttga cactcataga
    4751  ttcagaacca ttggacaata cgcaactctt ggatacatgc gcacagacga
    4801  aaagcatcat ttggtattac catttcacca caatgacgtg agcgttgaat
    4851  ttgctgaaag gattggcgaa gcctatatag cctctcaagt cccgacatca
    4901  attaagctgc gcgtacctgc ggtcaatcat agagaagtgg cgatgaagat
    4951  gtcagcaaat cctgaagatg tgggaaccat attgtatatg gttgagcaag
    5001  cgctaataag tgaaaagacg aaactggaga atctaactca ggcattccag
    5051  cagcaacaat caacatattg cagcgtgctt attcctaatt tcaatgttgc
    5101  tggtcggcta acacaggcaa tggatcgcat aagaaagaat gtttctgtgc
    5151  tacaacacca aaaaacagct ctcgaaaagg cagcagtgac ttacgactac
    5201  acgaagttag ttgagctcct tgacgaaaat ccaagcatag cttcccatgt
    5251  ttcataccag gctgggccag caaaattcat tgatgaattc atattggaga
    5301  agcgcgatta tgggtggcta ccgtatcttg cagtaggaac tgcgtgtgca
    5351  attgctggca caacacttgt gatgatgtac taccgtcgca tgaagcgtag
    5401  tgtcaagttc gagggcaaag cagcacgcaa cagtagtgca aaacgacaat
    5451  cagcaagaga tcaaaagatg gagcgtggca acgaatacac atactacgat
    5501  gctggtgaca ccttgtataa tggagttcaa gagaatatga atcatgcacc
    5551  agactggacc gaccggatta agaagaagac tcatgcatac gcaatgcaat
    5601  ttggtaggga agtaccaaaa actgaagcac agcgatcctc acaatactgg
    5651  cacttctacg gttttgatcc aaagatgtat gattcagtcg aatttaagga
    5701  catatcagca aacttctcag tgcatcagga tgcaaaggca atggatttgc
    5751  agaaggcctt cacagaaatg gtggaaaatc gttgggatga tgaagacttc
    5801  ttcgacgaga agataccaaa gcgagttttg gccatcttca ggaaaggaga
    5851  caaggttcgt gaagttgcat tggcacctca caagccaaac caagtcaaca
    5901  agcgtgggct acccgtcgga catgctgatc acagaggaga gtggagacaa
    5951  acacagcctt catttgaaaa agaagtgtcg tacgagaaca aatcaacttt
    6001  cgaaggtgca cgttcacttg atcatatcca tcagaatcaa gtcatcctcg
    6051  ttgaagacaa tcaacagtta aatgggctaa tagttggaaa catactcttg
    6101  gcgccatatc atttcacacg gggtatgagg aacagagagg agaaggaaac
    6151  acgcatgttg acacagtttg gaacgtataa tcttggaaaa cttaccaaca
    6201  agcatgtcac aaaattcaca atgatggatc tggtagcatt aacattacct
    6251  ccaacatttc aagcaagacg gaaactcaaa tgtttcagac caccaaggga
    6301  aggagagcga gcaatgctgg tgaccatgca gtacgagaaa gcaggatggg
    6351  ttgccaagca atcagcggaa acaacaatca caccattcgg tgatcgacat
    6401  gatggtttgt ggaagcatag aatttcaaca ggaccaggtg actgtggaag
    6451  tgccatagta gcagtagcag acctaaaagt tgtgggattc cataaccttg
    6501  gagggaaagg tgagaattac ttcacaccga taactattga ggtcatggat
    6551  ttcttagctg aaaagtctgt aacaccgctt gtgccatgga agttctcaga
    6601  cgagcaagtt gacttgtgtg gtttaattgc gaccaatgga gcagacaaat
    6651  acccattcac caaaacaata agcgacttgg ttagttggca aagtctccaa
    6701  atgacgaaat attgtgggga gaacttcaag gctatcgctt acgctccaaa
    6751  ccgaatgtca aaaaggcatg tcattacagg aaagaggcct gaattcatta
    6801  aatttctaga ttcccacccg aagtggaatg cagtggtaac acctttctta
    6851  aacgagtttc aaccatcagt cctgacacat gaagcatatt acaaggatgt
    6901  gttgaagtat aacaaagaca taattgttgg agggactgac gaagtgtgtt
    6951  tcgcgaaggc agtggtcgca accattggga ttctagaaat agccggattt
    7001  tcaaagggac aatttcaacc aatctttgat ggatgtaaaa ttttcaatga
    7051  cttgaattta gatgccgcaa tgggagcttt gtactcaggg aagaaatctg
    7101  catactttga cggagcaaca agcgacgaaa tcaatgaatt ctttgaactg
    7151  agtgcagcga agctactcag taacggacat ggagtatggt ctggtttact
    7201  caaagctgag ttgagaccga aggcaaaggt cgtggcgaac aaaacgcgaa
    7251  cattcacatc agcaccaatt gatatactca tgggtgccaa agctgtggtt
    7301  gatgagttca acaaattctt ctacacaaag catctgcgcg gaccatggac
    7351  cgtcggcatc aataagttta acggaggttg ggatttgttg gccaaaaatc
    7401  taatggtgta cgagtggttc attgacgctg atggttctca attcgacagt
    7451  tcaatcactc cacttctgat gaatgcaatt cttaacatac ggcaatactt
    7501  catggcagaa gatgttgaag ctgaacaaat gctggcaaat ttgtatacgc
    7551  aaattataaa cacatgcatt ttaattgaag atgggacgat tgtgcagaag
    7601  tttcgaggta ataacagtgg ccaaccaagc acagttgtcg acaacacgat
    7651  gtgtttaatc atagctatgg agtattgcag aatgcgtgta gaaaaggatc
    7701  atggacatag aatgaggata ctgtacgtgt gcaacgggga tgatttgctt
    7751  atcaatgccg acacaaagga caaagatttc atacagcagt attttgccga
    7801  ttacatgcgc gaactggagc tgaattactc atttgacgag gcttaccgta
    7851  gtatcgagga ggtggaatac atgtcacaca cattcatgaa gcgaaattcg
    7901  atgtacattc caaagttgaa gcgcgaacga attgtggcaa tcctggagtg
    7951  gcagaggagc aaggaaccga aggctattca gagcgctatt attgcagcat
    8001  acgtggaagc tttcggttat gatgaattca cggagatgat tgaagaactt
    8051  gcgcaggagg tttcagcggt gtggccagat ttcaagttgc cctcacgaca
    8101  agaggttgag gatttgtact tgactgggac tcgaacggat ttaggagaag
    8151  agattaagga atgtggagag caatactgcg tgtacgaatc gagtgaggcc
    8201  gcaaccgacg ctgtcttggc ggcagcaaat gcaggaactg gtagtgaacc
    8251  gagcagtgga agtactcaat caagtctgag cgcaagtact gctagcggat
    8301  cagggagctc accatcagga tcaggttctg gagcagtggg tgaatcaggt
    8351  tctggatcag cacaaacaca atctaataac gtatctgtca tggctggcct
    8401  cgacacggga ggaactaaga caggtcaagg atcaggatca aaagggacga
    8451  gtggttcatt cgtatcgaat cccgtgcgaa ctggaggccg agcaacggat
    8501  gtgcaagatc agacaccagg gttagtgttt ccagcaccaa agatcacaac
    8551  aaaggccata tacatgccaa aaactgtacg cgacaagata aagcctgaaa
    8601  tgataaataa catgatcaaa taccaaccgc gtgcggaact tatcgacaac
    8651  agatatgcaa caactgaaca gctcaacacc tggatagaag aggcatctga
    8701  agggcttgac gtgacagagg aagttttcat aaacacctta cttccaggat
    8751  gggtctacca ctgcataatc aacacaacga gcccagagaa cagagcacta
    8801  ggaacttggc gtgttgtgaa taatgcaggc aaggacaatg agcagcaact
    8851  cgagtttaaa attgaaccga tgtacaaagc cgcgaagcca tcacttcgag
    8901  ccattatgcg tcactttggc gagggagctc gagtgatgat cgaggagagt
    8951  gttcggattg gaaaacctat cataccaagg ggcttcgaca aggccggtgt
    9001  gctaagcatc aacaatattg tggcagcgtg tgatttcatt atgcgcggtg
    9051  cagatgacac accaaatttt gtgcaagtgc agaacagcgt tgcagtgaac
    9101  aggctacgcg gaatacagaa caagctgttt gcacaggcac gactgagtgc
    9151  gggtactaat gaggacaact cacgtcatga tgcagatgat gtgagggaga
    9201  acacgcacag tttcaatggt gtaaacgctc ttgcgtgagc acagtagaaa
    9251  ccacaaatcc acgagtacca ggatttgagc ggaataacgc tgcgtttcgt
    9301  taacccttcg ttgttactag gtgtgtactt ctccacgaga ggcgtgcatt
    9351  cttggtagct atgtgtgggt tagggcgacg ctac