!!NA_SEQUENCE 1.0
ID   AF285170   standard; RNA; VRL; 9339 BP.
XX
AC   AF285170;
XX
SV   AF285170.1
XX
DT   02-NOV-2000 (Rel. 65, Created)
DT   12-APR-2001 (Rel. 67, Last updated, Version 2)
XX
DE   Wheat streak mosaic virus strain El Batan 3 complete genome.
XX
KW   .
XX
OS   Wheat streak mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Tritimovirus.
XX
RN   [1]
RP   1-9339
RA   Choi I.-R., Hall J.S., Henry M., Zhang L., Hein G.L., French R.,
RA   Stenger D.C.;
RT   "Contributions of genetic drift and negative selection on the evolution of
RT   three strains of wheat streak mosaic tritimovirus";
RL   Arch. Virol. 146(3):619-628(2001).
XX
RN   [2]
RP   1-9339
RA   Choi I., Hall J.S., Henry M., Zhang L., Hein G.L., French R., Stenger D.C.;
RT   ;
RL   Submitted (06-JUL-2000) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS, University of Nebraska, 344 Keim Hall, Lincoln, NE 68583, USA
XX
DR   SPTREMBL; Q9E160; Q9E160.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .9339
FT                   /db_xref="taxon:31741"
FT                   /organism="Wheat streak mosaic virus"
FT                   /strain="El Batan 3"
FT   CDS             131. .9193
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9E160"
FT                   /product="polyprotein"
FT                   /protein_id="AAG28732.1"
FT                   /translation="MASANCLLGEFGKQGVVANDPYVRCRARTLLFLSTEEEVDVVVNH
FT                   HGPGSIFWSKDGVLTQTGKNLYKATMNGLGYDLAANVFVCGKCRSSCTHYRYFVEDHYA
FT                   CDKLVEKNCAYIKTDKYVRVVDAFPIMPAYATAAQEARIIQWMSKTSQCLADHCVQYKR
FT                   EVTFVNAKTKEEETRSKDSCAEVYYDEFDEDHTVTEHAHRKNPLHEYKEKQLRMTSSNI
FT                   SALVDQVTRLMYSQGKTIEIVGSKGHKKFAKIPLKHTMGYPKREWDGCKDVPEDMRSFI
FT                   TTYSSVIQYTRKVQDHEITLGWSGVVLSEFDVPDGYQEDCVDGLFIVMGRCAHGRIQNA
FT                   LKPRCIHGLRWYGDSPVNSAIPKQHDTCNNNCAGYLDALPKKVSRVWQAMFDIHNLKCD
FT                   ECRAEWKARTGAEHTQMLRKSIANYVQTYPDSDVTLFKSFLQALGSEEVSGVKQFKPSG
FT                   TLQLVDVWRTMKSTINIPNRIIYMGMFTDNYGNFDFFPNTSMPELFATYMQPVHHRLLE
FT                   DGTIDTNFRFVDVERQIQTSIESLYPVFDSIYWNEQARRVHRIQPLTDCAMEINGETKP
FT                   ICHWEGNVPLYNPIIRATPGQLPFGMTTHLLSVNDRSGRYHYVPKNGYCYMYIFACAMI
FT                   FCGNSNRSTVDAFVRQVCEDLGPWPTFGEVLRQLDWMATFYGCYDALVPVILVDHTKKT
FT                   MHVPTPYGVKQSGMHTIRVNTVLELITLDTMASGAMKDYKIGGFQETVLSIHACVKSRK
FT                   EFVRKINKDAEWLVDMFINPSTLFVLGGLIEVHQVILADVENSFDKSAALLNLRQMALK
FT                   LGPHLESKQRVRQYMELMIQHRASVEAIIPSQHMKAEMMQYIDALQRSILEEQAILEMD
FT                   RVGGKEKMLIEQDLSHAECAFNEFFNSIGYLNFHGTVLRLTYSGPGRKVGEMLESLKDN
FT                   WLTRYLRGPSQPRDYKGSSLRIWRKVTHLCGNAYRWVFYNMAANVLQVILIGLSTVFGA
FT                   YLLKKILKMLQWEKEQESAELVEYQGKREEAWITRIMAVLYIIASLFSVDFSSALYSNL
FT                   VKFRTIFDILKFNCEYQSGIFESLKNQLGNIPAFHEMHLYDHEATQVAVPPAVLTFERW
FT                   FETRITSGQQGYAPLDGNHVSLTMTKDTVGDVATQVQASKANEFLIIGHVGCGKSTAFP
FT                   ATLSRNGRVMICEPTRVLVTNLQDSMLATKNLSISAMMRHHRVMTASNITVTTYGYAFH
FT                   YLYNNSHNLAEYDYILFDEVHQTSAEMLVFYNWLKSTTWSGKLIKLTATNNTVNGDMQT
FT                   QQALDVKTWPVMDHRTFMQEQGRGTAHDASVLGDVVIVFLTSFREIDESADILSKNGKI
FT                   GVIKADSRHLRNKVSLMDDVEALRAEKKYILATNILQNGVNLHADVVVDFGFKIVPTID
FT                   SDNRMITVKRQLINKSDRIQRLGRVGRMKMGYARKIGNDIDASFALDEVTATEAALLAF
FT                   GFGVAPVLQNVDQHTFGKITAEQIRTAARFEMQLSYMVWMVNRDGTMATRLYEQFKPLL
FT                   LTPGNTSLAPYYETLVDTHRFRSIGQYVSLGYMRTDEKHHLILPFHHNDISVEFACKIG
FT                   EAYLESQVPTSIKLRVPAVNHREVAMKMSANPEDVGTILYMVEQALINEKTKLENLTQA
FT                   FQQQQSTYCSVLIPNFNVAGRLTQAMDRIRKNVSVLQHQKTALEKATVTYDYTKLVELL
FT                   DENPSIASHVSYQAGPAKFIDEFILEKRDYGWLPYLAVGTACTVAGTALVVMYYRRMKR
FT                   SVKFEGKAARNRNAKRQSARDQKMERGNEYTYYDAGDTLYDGVQENMNHTPDWTDRIKK
FT                   KTQAHAMQFGREVPKTESQRSSQYWHFYGFDPKMYDSVEFKDIAANFSVHQDAKAMDLQ
FT                   KAFTEMVENRWDDEDFFDEKIPKRVLAIFRKGDKVREVALAPHKPNQVNKRGLPVGYAD
FT                   HRGEWRQTQPSFEKEVSYENKSLFEGARSLDHIHQNQVILVEDNQQLNGLIVGNILLAP
FT                   YHFTRNMRNREEKETRMLTQFGTYNLGKLTEKHVTKFTMMDLVALTLPPTFQARRRLKC
FT                   FRPPREGERAILVTMHYDKAGWVGKQSAETAITPYGDRHDGLWKHKITTSAGDCGSAIV
FT                   AVADLKVVGFHNLGGKGENYFTPVTSEVMEFLAEKAVIPLVPWKFSDEHVDLCGLIAAN
FT                   GADKFPFSKQISDLVSWQSLQMTKYCGENFKAIAYAPNRMSKRHVITGRRPEFVKFLDS
FT                   HPKWNALVTPYLNEFQPSILNHEAYYKDVLKYNKDIVVGGTDEVCFAKAVVATVEALKV
FT                   AGFVKGQFNPVFDGCKVFNDLNLDAAMGALYTGKKSAYFDGATSDEINELFEHSAAKLL
FT                   SNGHGVWSGLLKAELRPKAKVAANKTRTFTSAPIDILMGAKAVVDEFNKFFYTRHLRGP
FT                   WTVGINKFNGGWNLLAENLMVHEWFIDADGSQFDSSITPLLMNAVLNIRQYFMVEDEEA
FT                   ELMLSNLYTQIINTCILIEDGTIVQKFRGNNSGQPSTVVDNTMCLIIAMEYCRLRVAKE
FT                   YGHDMRFLYVCNGDDLLINANTQDKDFVQQHFANYMRELELNYSFDEAYRSIEEVEYMS
FT                   HTFVKRGSMFIPKLKRERIVAILEWQRSKEPKAIQSAIIAAYVEAFGYDDFTEMIEELA
FT                   HEVSQIWPDFKLPTRQEVEDLYLTGNRTDLGEEAKECAEQYCVYESSTSATEDVLAAAD
FT                   AGTNGASSSGNAQAGSSTGSASGSSSAASQSQAGGTSTMAGVDTGRAKVGQASGSKGTS
FT                   GSFISNPVRNGGRATDVQDQTPGLVFPAPKITTKAIYMPRNVREKIKPEMINNMIKYQP
FT                   RAELVDNRYATIEQLNTWIKEASDGLDVTEDVFVNTLLPGWVYHCIINTTSPENKALGT
FT                   WRVVNNVGKDNEEQHEYKIDPMYKAAKPSLRAIMRHFGEGARVMIEESVRIGKPIIPRG
FT                   FDKAGVLSVNNIVAACDFIMRTSDDTPNFVQVQNSVAVNRLRGIQNKLFAQARLSAGTN
FT                   EDNSRHDADDVRENTHSFNGVNALA"
XX
SQ   Sequence 9339 BP; 2869 A; 1907 C; 2371 G; 2192 T; 0 other;

AF285170  Length: 9339  December 21, 2001 14:59  Type: N  Check: 1992  ..
       1  aaattaaacc aacccaaaac aatctgacaa cgaacaacgc acactcacag
      51  caaccacaag ctcaagttac gcatcgttca ttgaatagga agcaatttgt
     101  tcattgtgag ctctcgcata gagataagca atggcttcag cgaattgttt
     151  gctcggtgaa tttggaaagc agggggtcgt cgctaacgac ccatatgtac
     201  ggtgcagggc gcgcacgctg ctatttttaa gcactgagga agaggttgat
     251  gtggtggtca accaccacgg accaggaagc attttctggt caaaggatgg
     301  agttttaacc caaacgggga aaaacctcta taaagcaaca atgaatggct
     351  tgggttacga tctcgcagcc aacgtatttg tttgcggcaa gtgcagatcc
     401  agttgcactc actataggta cttcgttgag gatcactacg cctgcgacaa
     451  gctcgtggag aagaattgcg cgtacatcaa gactgacaag tacgtgagag
     501  tagtggatgc attcccaatc atgccagcgt atgccacagc agcgcaagaa
     551  gcacgcataa tacaatggat gagtaaaacc agccagtgtc ttgcggacca
     601  ctgtgtgcag tataagcgtg aggtcacatt tgtgaacgcc aaaaccaagg
     651  aggaagaaac gcgctccaag gacagctgcg cagaagttta ctacgatgaa
     701  ttcgatgaag atcacacagt aacagagcac gcacatagga agaacccact
     751  acatgagtac aaggagaaac aactaaggat gacctcaagt aacatatctg
     801  cactggttga ccaggtcacc aggctcatgt attcacaagg gaaaactatt
     851  gaaatcgtcg gaagcaaggg gcacaagaag ttcgccaaga taccattgaa
     901  gcacacaatg gggtatccaa agcgagaatg ggatggatgc aaggatgttc
     951  ctgaggatat gcgaagcttc ataaccacgt acagcagcgt gatacaatac
    1001  acacgtaagg ttcaggacca cgaaattact cttgggtgga gtggtgtagt
    1051  gttgagcgag tttgatgtcc cagatggata tcaggaggac tgtgtcgatg
    1101  ggctcttcat tgttatgggg agatgcgctc atgggcgaat ccaaaacgca
    1151  ctaaaaccga gatgcataca tggtttgcgc tggtatgggg attcacctgt
    1201  gaatagtgcc attccaaaac aacatgacac atgcaacaat aattgcgcag
    1251  gctatttgga tgctctacca aagaaggtaa gtcgcgtgtg gcaagcaatg
    1301  ttcgacatcc ataaccttaa gtgcgatgaa tgtcgagccg aatggaaggc
    1351  tagaacaggc gctgagcata cgcagatgtt acgaaagtca atagcgaatt
    1401  atgttcaaac atacccggac agcgacgtaa cacttttcaa atcatttttg
    1451  caagcactag gttcggaaga agtaagtgga gtcaagcagt tcaaacctag
    1501  tggtacgttg cagttagtgg atgtttggcg aactatgaag agcaccataa
    1551  atattccaaa cagaattatt tatatgggta tgttcacgga taattatggg
    1601  aatttcgatt tctttccaaa cacttcgatg cccgaactgt tcgcaacgta
    1651  catgcaacca gtgcatcata ggctacttga agacgggaca attgacacaa
    1701  attttcgatt tgttgatgtc gagaggcaaa tacaaacgag cattgaaagt
    1751  ttatatcccg tgtttgatag catttattgg aacgagcaag cacgaagagt
    1801  ccacaggatt caacctctca cggactgcgc aatggaaatt aatggtgaga
    1851  ctaaacccat ctgccactgg gaaggaaacg tccctttgta taacccgata
    1901  attcgagcaa caccaggaca actaccattc gggatgacaa cacatctgct
    1951  aagtgtaaat gacaggagtg gaagatacca ctatgtaccg aagaatgggt
    2001  attgctacat gtacattttt gcatgtgcaa tgatcttctg cggtaatagc
    2051  aatcgatcaa ctgttgacgc attcgtgagg caagtatgtg aagatctggg
    2101  tccgtggcca acttttggag aggttctgag gcaactcgac tggatggcca
    2151  cattctacgg ttgctatgat gcactagtgc cagtaatact cgtagatcac
    2201  acgaagaaga caatgcacgt tcctactcca tacggagtca agcagtcagg
    2251  aatgcacacc attcgggtca atacagttct cgaactgatc acattggaca
    2301  caatggcgag cggagcgatg aaagactaca agattggtgg tttccaggag
    2351  acagtcttga gtattcatgc gtgcgtcaag agccgaaaag aatttgtgcg
    2401  gaaaattaac aaggatgccg aatggctagt ggatatgttt attaacccat
    2451  ctacactttt tgtgttaggt gggttgatcg aagtgcacca agtcatacta
    2501  gcagacgtgg agaactcgtt tgataaatcg gcagcactat tgaacttgcg
    2551  ccaaatggca ttgaaactcg gaccacactt ggaatcaaag caacgagtgc
    2601  gccaatacat ggagttgatg attcaacacc gagcatcagt agaggccata
    2651  atcccatcac aacatatgaa ggccgaaatg atgcaataca ttgatgcact
    2701  acaacgatcc attctcgaag agcaggcaat actcgaaatg gatagagttg
    2751  gaggaaagga aaaaatgctc atcgagcaag atctttcaca cgcagagtgt
    2801  gctttcaacg aattcttcaa ctcaattggt tacttaaact ttcatggaac
    2851  cgtgctacga ctcacatatt ctggtccagg aagaaaggtt ggagaaatgc
    2901  tcgagagttt aaaagacaat tggttaacgc gctatctccg aggaccgagt
    2951  cagccgagag actacaaagg gagttccttg aggatttgga ggaaggttac
    3001  tcacctttgc ggaaacgcgt acagatgggt gttttacaac atggccgcga
    3051  acgtcttgca agttatactc ataggccttt ctaccgtttt cggagcgtat
    3101  ttattaaaga agatcttaaa aatgctgcag tgggagaagg aacaggaaag
    3151  tgctgaattg gtggagtatc aaggaaaacg agaagaagca tggataacta
    3201  ggattatggc tgtactatat atcatagctt cactattctc agtcgatttt
    3251  agttccgcac tatactcaaa ccttgtaaaa tttcgcacaa tttttgatat
    3301  actgaagttt aactgcgaat atcaaagtgg tatatttgag agcttaaaga
    3351  accaactcgg caacattcca gcattccacg aaatgcacct atacgaccac
    3401  gaggcaacac aagtcgcagt gccaccagca gtcctcacat ttgaaagatg
    3451  gttcgagacg cgcataacgt caggtcagca ggggtatgct ccattggatg
    3501  ggaatcatgt cagtctgaca atgacaaaag acacagtggg tgacgtagcc
    3551  acgcaagtgc aggctagcaa ggccaatgaa tttctcatta tcggtcatgt
    3601  tgggtgtgga aagtcgacag cttttccagc cactttgtca cggaatggcc
    3651  gtgtaatgat ttgcgagccc acgcgcgtgc ttgtaacaaa cttgcaggac
    3701  tcgatgctag caacaaagaa cttgagtatt agcgccatga tgagacatca
    3751  tagagtgatg acagcttcaa acatcacagt cacaacgtat ggatatgcat
    3801  ttcactactt gtacaataac tcacacaacc tggcagagta tgattatatc
    3851  ctatttgacg aagttcacca aacatcagca gagatgctag tgttctacaa
    3901  ctggctcaag agcacgacgt ggagtggcaa actgataaag ctgacagcaa
    3951  ccaataacac agtgaacggg gatatgcaaa ctcagcaagc acttgatgtt
    4001  aaaacttggc cggtcatgga tcacagaaca ttcatgcagg agcaagggcg
    4051  gggcacagca catgacgcgt ctgtacttgg cgacgtggta attgtcttct
    4101  tgacttcatt ccgtgagatt gacgagtcag cagacatcct aagcaagaat
    4151  ggtaaaattg gtgtcataaa agcagatagc cggcatttga ggaacaaggt
    4201  gagcttgatg gacgatgtag aggcattgcg ggccgagaag aagtacattc
    4251  tagcaactaa cattctgcaa aatggtgtga atttgcacgc ggatgttgtg
    4301  gttgacttcg gttttaagat tgtgcctacc attgatagtg ataatcggat
    4351  gattacagtc aagcgccaat tgattaacaa atcagatcgg attcaacggc
    4401  tgggccgagt tgggcgtatg aagatgggtt atgcacggaa gattgggaat
    4451  gacattgacg cctcatttgc attggatgaa gtaacagcaa cagaggctgc
    4501  tctactggcg ttcggatttg gtgtggcacc tgttttacaa aatgttgacc
    4551  aacacacatt tggtaaaata actgcagaac agataagaac agcagcacga
    4601  tttgaaatgc agttatcata catggtatgg atggtgaacc gtgatggaac
    4651  aatggctacg aggttgtacg agcaattcaa gcctctgctc ctaacaccag
    4701  gaaacacgag tttagctcca tattacgaaa cattggtcga cacacatagg
    4751  tttcgtagta ttggccagta tgtgtctttg ggctacatgc ggacagatga
    4801  gaaacaccat ctgattttac catttcacca taatgacatt agcgttgagt
    4851  ttgcttgtaa aattggtgaa gcatatttgg aatcacaagt cccaacgtca
    4901  atcaaattgc gcgtaccggc agttaatcac agggaagtcg ccatgaagat
    4951  gtccgccaat ccggaagatg tgggaaccat tctttatatg gttgagcaag
    5001  ctttaattaa cgagaaaacc aagctcgaga atctcacaca agcattccag
    5051  caacagcaat caacatattg tagtgttttg attccgaatt tcaatgttgc
    5101  tgggagatta actcaggcca tggatcgcat aaggaagaac gtgtcagtcc
    5151  ttcaacacca gaagacagca ctggaaaagg ccacggttac gtatgattac
    5201  acgaagttgg tggagttgct ggatgagaac ccaagtatag catcacatgt
    5251  gtcatatcaa gcgggtccag caaagttcat tgacgaattt attttggaga
    5301  agcgtgacta tggatggctg ccatatcttg cagttggaac agcatgcacc
    5351  gtggctggaa ctgcgcttgt ggtgatgtac tataggagga tgaagcgaag
    5401  cgttaaattc gagggcaagg cagcccgcaa caggaacgca aaacgacaat
    5451  cagcaaggga ccagaaaatg gaacgtggca atgagtacac atattatgat
    5501  gctggtgaca cactgtatga tggcgtgcaa gaaaatatga atcacactcc
    5551  tgactggaca gatcgaatca aaaagaaaac acaagcacat gcaatgcaat
    5601  ttgggcggga ggtcccaaaa actgaaagcc aacgttcatc tcaatattgg
    5651  cacttttatg gatttgatcc caagatgtat gattctgttg agttcaagga
    5701  tattgccgca aacttctcag ttcaccagga cgcaaaggca atggatttgc
    5751  agaaggcatt cacagagatg gtcgaaaacc gctgggacga cgaagacttc
    5801  tttgatgaga agataccaaa gcgcgtgcta gccattttca ggaaagggga
    5851  caaggttcgt gaagtcgcac ttgcaccgca caaaccgaac caggtaaata
    5901  agcgtggttt gccagtaggg tatgccgacc acagaggtga atggcgccag
    5951  acgcaaccat cttttgagaa agaggtgtca tacgagaaca aatcgctatt
    6001  cgaaggggcg cgctcactag accatataca tcaaaaccaa gttattttgg
    6051  ttgaggataa tcagcaactt aatggtctaa ttgttggcaa catacttttg
    6101  gcgccgtatc atttcacacg gaatatgcga aatagggagg agaaagaaac
    6151  tcggatgctc acacaatttg gcacctataa tcttgggaag ctaacggaaa
    6201  aacatgtcac caagtttaca atgatggatc tagtggcctt aacactacca
    6251  cccacatttc aagccaggcg ccgactcaaa tgcttcaggc ctccaaggga
    6301  aggcgaacga gcgatcctag tcaccatgca ctacgataag gcaggatggg
    6351  ttggaaaaca atcagctgaa acagctatca caccgtacgg cgatcgacac
    6401  gatggcttat ggaaacataa aatcacaacg tcagcagggg attgtggaag
    6451  cgcaattgtt gctgtagctg atttgaaggt tgttgggttt cacaacctcg
    6501  gagggaaggg cgagaattac tttacgccag tcacaagcga ggtaatggag
    6551  tttctcgcag agaaggccgt gattccgttg gttccgtgga agttttcaga
    6601  tgagcatgtt gatctgtgcg gattaatcgc ggccaatggt gcagataaat
    6651  ttccattctc aaagcaaatc agcgatttag tcagttggca gagccttcaa
    6701  atgacaaagt actgcggtga gaatttcaaa gcaattgcat atgcaccaaa
    6751  ccgcatgtca aagaggcacg tgataacagg acgaaggcct gaatttgtca
    6801  agtttttgga ttcccaccca aaatggaatg cgctagtgac tccctatctg
    6851  aatgaattcc agccatcaat tctgaatcat gaagcatatt ataaggatgt
    6901  cctgaagtac aacaaggaca tagtggttgg aggtacggat gaggtgtgct
    6951  ttgcgaaggc cgtggttgca actgttgagg ctctcaaggt ggcaggcttt
    7001  gtgaaaggac agttcaatcc tgtgtttgat ggatgtaaag tctttaacga
    7051  tctaaacctt gacgccgcta tgggcgcttt atacacagga aagaagtccg
    7101  catactttga tggagcaact agcgatgaaa taaacgaact ctttgaacat
    7151  agcgctgcta agttgctcag taatggacat ggagtttggt ctgggttgtt
    7201  gaaggcggag ctgagaccga aggcaaaggt ggccgcaaac aagactcgca
    7251  cattcacatc agcaccaatt gacattctta tgggtgctaa agccgttgtt
    7301  gatgaattta ataaattctt ttacacacgg cacttgcggg ggccttggac
    7351  cgttggcatc aacaaattta atggcgggtg gaacctgctt gcagaaaatc
    7401  tgatggtaca cgaatggttc atagatgctg atgggtccca gtttgacagt
    7451  tcaataaccc cacttctgat gaatgcagtc ctgaacatca ggcaatactt
    7501  catggtggaa gatgaagaag cggagttgat gctatcaaac ttgtatacgc
    7551  aaatcatcaa cacgtgcata ctcatcgaag atggaacgat cgtgcagaaa
    7601  tttcgaggta ataacagcgg tcagccgagc acagttgttg acaacacgat
    7651  gtgtcttatc attgcaatgg agtactgcag actgcgcgtc gcaaaggagt
    7701  atggtcatga catgagattc ctatatgtat gcaacgggga tgatttgcta
    7751  attaatgcca acacgcaaga taaggacttt gtgcaacaac actttgccaa
    7801  ctacatgcgg gagctggaat tgaattattc attcgacgag gcatatcgga
    7851  gcattgaaga agttgagtac atgtcgcaca catttgtcaa gcgaggatca
    7901  atgttcatac caaagctaaa gcgagagcgg atcgtggcca ttttggagtg
    7951  gcaacgaagc aaggagccaa aggccataca aagcgcaatt atagcagcat
    8001  atgtcgaagc ttttggatat gatgacttca cagagatgat tgaagagctg
    8051  gcgcacgaag tctcacaaat ctggccagat ttcaagctac caacacgaca
    8101  ggaagttgag gatttgtact taacaggaaa tcggacggat ttgggagaag
    8151  aagcgaagga gtgtgctgag caatactgtg tgtacgagtc aagcacgtca
    8201  gcaacagaag atgtgttggc agcggcagat gctgggacta atggtgcttc
    8251  aagcagtgga aacgcgcaag cagggtcaag cacaggatca gctagtgggt
    8301  ctagctctgc agcatcacaa tcacaagcag gtggcacttc cacaatggca
    8351  ggtgtggaca cagggagagc taaagttggg caagcttcag gatcaaaggg
    8401  cactagcggt tcattcattt cgaatccggt tcgaaatggt ggccgggcca
    8451  cagacgtgca ggaccagaca cctggcttgg tttttcccgc gcccaagatc
    8501  acaacaaaag ctatttatat gcccaggaat gtgcgcgaga aaataaagcc
    8551  agagatgatc aataacatga tcaagtacca accacgggcc gagcttgtcg
    8601  acaatagata cgccacgatt gagcaactca acacgtggat caaggaggcc
    8651  tcggatggtt tggatgtcac agaggatgtg tttgttaaca cactattacc
    8701  gggatgggtg taccattgca taatcaatac aaccagtccg gaaaacaaag
    8751  cactaggaac ctggcgtgtg gtgaataacg ttgggaagga taacgaagag
    8801  cagcatgaat acaagattga tcctatgtac aaagctgcaa aaccgtcgct
    8851  gcgcgcaatt atgcgacatt ttggcgaggg agcaagagtg atgattgagg
    8901  agagcgtcag gattggaaag cctataatac caagaggttt cgacaaagca
    8951  ggtgtgctga gtgtcaacaa tattgttgca gcgtgtgatt ttatcatgcg
    9001  cacttcagat gacacaccaa atttcgtgca ggtgcagaat agcgtagcgg
    9051  tgaataggct gcgcgggata cagaataaat tatttgcaca ggcacgattg
    9101  agtgcgggta ctaatgaaga caactcacgt cacgatgccg atgatgtgag
    9151  ggagaacacg cacagtttca atggtgtgaa cgctcttgcg taagcacagc
    9201  agaaactaca gatccatgag taccagggtt tgggcgaaat aacgctgcgt
    9251  ttcgttgacc tttcgtggtt actaggtgtg cacttcttca tgaaaggcgt
    9301  gcattcttgg tagctatgtg tgggttaggg caacgctac