!!NA_SEQUENCE 1.0
ID   AF314165   standard; genomic RNA; VRL; 6791 BP.
XX
AC   AF314165;
XX
SV   AF314165.1
XX
DT   05-JAN-2001 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 3)
XX
DE   Tobacco rattle virus strain ppK20 segment RNA1, complete sequence.
XX
KW   .
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-6791
RX   MEDLINE; 21097021.
RX   PUBMED; 11169199.
RA   Ratcliff F., Martin-Hernandez A.M., Baulcombe D.C.;
RT   "Technical Advance. Tobacco rattle virus as a vector for analysis of gene
RT   function by silencing";
RL   Plant J. 25(2):237-245(2001).
XX
RN   [2]
RP   1-6791
RA   Martin-Hernandez A.M., Ratcliff F., Baulcombe D.C.;
RT   ;
RL   Submitted (16-OCT-2000) to the EMBL/GenBank/DDBJ databases.
RL   The Sainsbury Laboratory, John Innes Centre, Colney Lane, Norwich NR4 7UH,
RL   UK
XX
DR   GOA; Q9DL34.
DR   GOA; Q9DL35.
DR   SPTREMBL; Q9DL33; Q9DL33.
DR   SPTREMBL; Q9DL34; Q9DL34.
DR   SPTREMBL; Q9DL35; Q9DL35.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6791
FT                   /db_xref="taxon:12295"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Tobacco rattle virus"
FT                   /strain="ppK20"
FT                   /segment="RNA1"
FT   CDS             203. .5326
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DL34"
FT                   /db_xref="SPTREMBL:Q9DL34"
FT                   /note="part of the complete replicase; readthrough stop
FT                   codon"
FT                   /transl_except=(pos:3764. .3766,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAG46032.1"
FT                   /translation="MANGNFKLSQLLNVDEMSAEQRSHFFDLMLTKPDCEIGQMMQRVV
FT                   VDKVDDMIRERKTKDPVIVHEVLSQKEQNKLMEIYPEFNIVFKDDKNMVHGFAAAERKL
FT                   QALLLLDRVPALQEVDDIGGQWSFWVTRGEKRIHSCCPNLDIRDDQREISRQIFLTAIG
FT                   DQARSGKRQMSENELWMYDQFRENIAAPNAVRCNNTYQGCTCRGFSDGKKKGAQYAIAL
FT                   HSLYDFKLKDLMATMVEKKTKVVHAAMLFAPESMLVDEGPLPSVDGYYMKKNGKIYFGF
FT                   EKDPSFSYIHDWEEYKKYLLGKPVSYQGNVFYFEPWQVRGDTMLFSIYRIAGVPRRSLS
FT                   SQEYYRRIYISRWESMVVVPIFDLVESTRELVKKDLFVEKQFMDKCLDYIARLSDQQLT
FT                   ISNVKSYLSSNNWVLFINGAAVKNKQSVDSRDLQLLAQTLLVKEQVARPVMRELREAIL
FT                   TETKPITSLTDVLGLISRKLWKQFANKIAVGGFVGMVGTLIGFYPKKVLTWAKDTPNGP
FT                   ELCYENSHKTKVIVFLSVVYAIGGITLMRRDIRDGLVKKLCDMFDIKRGAHVLDVENPC
FT                   RYYEINDFFSSLYSASESGETVLPDLSEVKAKSDKLLQQKKEIADEFLSAKFSNYSGSS
FT                   VRTSPPSVVGSSRSGLGLLLEDSNVLTQARVGVSRKVDDEEIMEQFLSGLIDTEAEIDE
FT                   VVSAFSAECERGETSGTKVLCKPLTPPGFENVLPAVKPLVSKGKTVKRVDYFQVMGGER
FT                   LPKRPVVSGDDSVDARREFLYYLDAERVAQNDEIMSLYRDYSRGVIRTGGQNYPHGLGV
FT                   WDVEMKNWCIRPVVTEHAYVFQPDKRMDDWSGYLEVAVWERGMLVNDFAVERMSDYVIV
FT                   CDQTYLCNNRLILDNLSALDLGPVNCSFELVDGVPGCGKSTMIVNSANPCVDVVLSTGR
FT                   AATDDLIERFASKGFPCKLKRRVKTVDSFLMHCVDGSLTGDVLHFDEALMAHAGMVYFC
FT                   AQIAGAKRCICQGDQNQISFKPRVSQVDLRFSSLVGKFDIVTEKRETYRSPADVAAVLN
FT                   KYYTGDVRTHNATANSMTVRKIVSKEQVSLKPGAQYITFLQSEKKELVNLLALRKVAAK
FT                   VSTVHESQGETFKDVVLVRTKPTDDSIARGREYLIVALSRHTQSLVYETVKEDDVSKEI
FT                   RESAALTKAALARFFVTETVLXRFRSRFDVFRHHEGPCAVPDSGTITDLEMWYDALFPG
FT                   NSLRDSSLDGYLVATTDCNLRLDNVTIKSGNWKDKFAEKETFLKPVIRTAMPDKRKTTQ
FT                   LESLLALQKRNQAAPDLQENVHATVLIEETMKKLKSVVYDVGKIRADPIVNRAQMERWW
FT                   RNQSTAVQAKVVADVRELHEIDYSSYMYMIKSDVKPKTDLTPQFEYSALQTVVYHEKLI
FT                   NSLFGPIFKEINERKLDAMQPHFVFNTRMTSSDLNDRVKFLNTEAAYDFVEIDMSKFDK
FT                   SANRFHLQLQLEIYRLFGLDEWAAFLWEVSHTQTTVRDIQNGMMAHIWYQQKSGDADTY
FT                   NANSDRTLCALLSELPLEKAVMVTYGGDDSLIAFPRGTQFVDPCPKLATKWNFECKIFK
FT                   YDVPMFCGKFLLKTSSCYEFVPDPVKVLTKLGKKSIKDVQHLAEIYISLNDSNRALGNY
FT                   MVVSKLSESVSDRYLYKGDSVHALCALWKHIKSFTALCTLFRDENDKELNPAKVDWKKA
FT                   QRAVSNFYDW"
FT   CDS             203. .3766
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DL35"
FT                   /db_xref="SPTREMBL:Q9DL35"
FT                   /note="part of complete replicase; has helicase and
FT                   nucleotide binding motifs"
FT                   /product="putative replicase"
FT                   /protein_id="AAG46035.1"
FT                   /translation="MANGNFKLSQLLNVDEMSAEQRSHFFDLMLTKPDCEIGQMMQRVV
FT                   VDKVDDMIRERKTKDPVIVHEVLSQKEQNKLMEIYPEFNIVFKDDKNMVHGFAAAERKL
FT                   QALLLLDRVPALQEVDDIGGQWSFWVTRGEKRIHSCCPNLDIRDDQREISRQIFLTAIG
FT                   DQARSGKRQMSENELWMYDQFRENIAAPNAVRCNNTYQGCTCRGFSDGKKKGAQYAIAL
FT                   HSLYDFKLKDLMATMVEKKTKVVHAAMLFAPESMLVDEGPLPSVDGYYMKKNGKIYFGF
FT                   EKDPSFSYIHDWEEYKKYLLGKPVSYQGNVFYFEPWQVRGDTMLFSIYRIAGVPRRSLS
FT                   SQEYYRRIYISRWESMVVVPIFDLVESTRELVKKDLFVEKQFMDKCLDYIARLSDQQLT
FT                   ISNVKSYLSSNNWVLFINGAAVKNKQSVDSRDLQLLAQTLLVKEQVARPVMRELREAIL
FT                   TETKPITSLTDVLGLISRKLWKQFANKIAVGGFVGMVGTLIGFYPKKVLTWAKDTPNGP
FT                   ELCYENSHKTKVIVFLSVVYAIGGITLMRRDIRDGLVKKLCDMFDIKRGAHVLDVENPC
FT                   RYYEINDFFSSLYSASESGETVLPDLSEVKAKSDKLLQQKKEIADEFLSAKFSNYSGSS
FT                   VRTSPPSVVGSSRSGLGLLLEDSNVLTQARVGVSRKVDDEEIMEQFLSGLIDTEAEIDE
FT                   VVSAFSAECERGETSGTKVLCKPLTPPGFENVLPAVKPLVSKGKTVKRVDYFQVMGGER
FT                   LPKRPVVSGDDSVDARREFLYYLDAERVAQNDEIMSLYRDYSRGVIRTGGQNYPHGLGV
FT                   WDVEMKNWCIRPVVTEHAYVFQPDKRMDDWSGYLEVAVWERGMLVNDFAVERMSDYVIV
FT                   CDQTYLCNNRLILDNLSALDLGPVNCSFELVDGVPGCGKSTMIVNSANPCVDVVLSTGR
FT                   AATDDLIERFASKGFPCKLKRRVKTVDSFLMHCVDGSLTGDVLHFDEALMAHAGMVYFC
FT                   AQIAGAKRCICQGDQNQISFKPRVSQVDLRFSSLVGKFDIVTEKRETYRSPADVAAVLN
FT                   KYYTGDVRTHNATANSMTVRKIVSKEQVSLKPGAQYITFLQSEKKELVNLLALRKVAAK
FT                   VSTVHESQGETFKDVVLVRTKPTDDSIARGREYLIVALSRHTQSLVYETVKEDDVSKEI
FT                   RESAALTKAALARFFVTETVL"
FT   CDS             5328. .6086
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DL33"
FT                   /product="movement protein"
FT                   /protein_id="AAG46033.1"
FT                   /translation="MEDKSLVTLKKKTFEVSKFSNLGAIELFVDGRRKRPKYFHRRRET
FT                   VLNHVGGKKSEHKLDVFDQRDYKMIKSYAFLKVVGVQLVVTSHLPADTPGFIQIDLLDS
FT                   RLTEKRKRGKTIQRFKARACDNCSVAQYKVEYSISTQENVLDVWKVGCISEGVPVCDGT
FT                   YPFSIEVSLIWVATDSTRRLNVEELNSSDYIEGDFTDQEVFGEFMSLKQVEMKTIEAKY
FT                   DGPYRPATTRPKSLLSSEDVKRASNKKNSS"
FT   CDS             6111. .6536
FT                   /codon_start=1
FT                   /product="16 kDa protein"
FT                   /protein_id="AAG46034.1"
FT                   /translation="MTCVLKGCVNEVTVLGHETCSIGHANKLRKQVADMVGVTRRCAEN
FT                   NCGWFVCVVINDFTFDVYNCCGRSHLEKCRKRVETRNREIWKQIRRNQAENMSATAKKS
FT                   HNSKTSKKKFKEDREFGTPKRFLRDDVPFGIDRLFAF"
XX
SQ   Sequence 6791 BP; 1987 A; 1132 C; 1746 G; 1926 T; 0 other;

 AF314165  Length: 6791  January 7, 2004 15:41  Type: N  Check: 607  ..
       1  ataaaacatt tcaatccttt gaacgcggta gaacgtgcta attggatttt
      51  ggtgagaacg cggtagaacg tacttatcac ctacagtttt attttgtttt
     101  tctttttggt ttaatctatc cagcttagta ccgagtgggg gaaagtgact
     151  ggtgtgccta aaaccttttc tttgatactt tgtaaaaata catacagata
     201  caatggcgaa cggtaacttc aagttgtctc aattgctcaa tgtggacgag
     251  atgtctgctg agcagaggag tcatttcttt gacttgatgc tgactaaacc
     301  tgattgtgag atcgggcaaa tgatgcaaag agttgttgtt gataaagtcg
     351  atgacatgat tagagaaaga aagactaaag atccagtgat tgttcatgaa
     401  gttctttctc agaaggaaca gaacaagttg atggaaattt atcctgaatt
     451  caatatcgtg tttaaagacg acaaaaacat ggttcatggg tttgcggctg
     501  ctgagcgaaa actacaagct ttattgcttt tagatagagt tcctgctctg
     551  caagaggtgg atgacatcgg tggtcaatgg tcgttttggg taactagagg
     601  tgagaaaagg attcattcct gttgtccaaa tctagatatt cgggatgatc
     651  agagagaaat ttctcgacag atatttctta ctgctattgg tgatcaagct
     701  agaagtggta agagacagat gtcggagaat gagctgtgga tgtatgacca
     751  atttcgtgaa aatattgctg cgcctaacgc ggttaggtgc aataatacat
     801  atcagggttg tacatgtagg ggtttttctg atggtaagaa gaaaggcgcg
     851  cagtatgcga tagctcttca cagcctgtat gacttcaagt tgaaagactt
     901  gatggctact atggttgaga agaaaactaa agtggttcat gctgctatgc
     951  tttttgctcc tgaaagtatg ttagtggacg aaggtccatt accttctgtt
    1001  gacggttact acatgaagaa gaacgggaag atctatttcg gttttgagaa
    1051  agatccttcc ttttcttaca ttcatgactg ggaagagtac aagaagtatc
    1101  tactggggaa gccagtgagt taccaaggga atgtgttcta cttcgaaccg
    1151  tggcaggtga gaggagacac aatgcttttt tcgatctaca ggatagctgg
    1201  agttccgagg aggtctctat catcgcaaga gtactaccga agaatatata
    1251  tcagtagatg ggaaagcatg gttgttgtcc caattttcga tctggtcgaa
    1301  tcaacgcgag agttggtcaa gaaagacctg tttgtagaga aacaattcat
    1351  ggacaagtgt ttggattaca tagctaggtt atctgaccag cagctgacca
    1401  taagcaatgt taaatcatac ttgagttcaa ataattgggt cttattcata
    1451  aacggggcgg ccgtgaagaa caagcaaagt gtagattctc gagatttaca
    1501  gttgttggct caaactttgc tagtgaagga acaagtggcg agacctgtca
    1551  tgagggagtt gcgtgaagca attctgactg agacgaaacc tatcacgtca
    1601  ttgactgatg tgctgggttt aatatcaaga aaactgtgga agcagtttgc
    1651  taacaagatc gcagtcggcg gattcgttgg catggttggt actctaattg
    1701  gattctatcc aaagaaggta ctaacctggg cgaaggacac accaaatggt
    1751  ccagaactat gttacgagaa ctcgcacaaa accaaggtga tagtatttct
    1801  gagtgttgtg tatgccattg gaggaatcac gcttatgcgt cgagacatcc
    1851  gagatggact ggtgaaaaaa ctatgtgata tgtttgatat caaacggggg
    1901  gcccatgtct tagacgttga gaatccgtgc cgctattatg aaatcaacga
    1951  tttctttagc agtctgtatt cggcatctga gtccggtgag accgttttac
    2001  cagatttatc cgaggtaaaa gccaagtctg ataagctatt gcagcagaag
    2051  aaagaaatcg ctgacgagtt tctaagtgca aaattctcta actattctgg
    2101  cagttcggtg agaacttctc caccatcggt ggtcggttca tctcgaagcg
    2151  gactgggtct gttgttggaa gacagtaacg tgctgaccca agctagagtt
    2201  ggagtttcaa gaaaggtaga cgatgaggag atcatggagc agtttctgag
    2251  tggtcttatt gacactgaag cagaaattga cgaggttgtt tcagcctttt
    2301  cagctgaatg tgaaagaggg gaaacaagcg gtacaaaggt gttgtgtaaa
    2351  cctttaacgc caccaggatt tgagaacgtg ttgccagctg tcaaaccttt
    2401  ggtcagcaaa ggaaaaacgg tcaaacgtgt cgattacttc caagtgatgg
    2451  gaggtgagag attaccaaaa aggccggttg tcagtggaga cgattctgtg
    2501  gacgctagaa gagagtttct gtactactta gatgcggaga gagtcgctca
    2551  aaatgatgaa attatgtctc tgtatcgtga ctattcgaga ggagttattc
    2601  gaactggagg tcagaattac ccgcacggac tgggagtgtg ggatgtggag
    2651  atgaagaact ggtgcatacg tccagtggtc actgaacatg cttatgtgtt
    2701  ccaaccagac aaacgtatgg atgattggtc gggatactta gaagtggctg
    2751  tttgggaacg aggtatgttg gtcaacgact tcgcggtcga aaggatgagt
    2801  gattatgtca tagtttgcga tcagacgtat ctttgcaata acaggttgat
    2851  cttggacaat ttaagtgccc tggatctagg accagttaac tgttcttttg
    2901  aattagttga cggtgtacct ggttgtggta agtcgacaat gattgtcaac
    2951  tcagctaatc cttgtgtcga tgtggttctc tctactggga gagcagcaac
    3001  cgacgacttg atcgagagat tcgcgagcaa aggttttcca tgcaaattga
    3051  aaaggagagt gaagacggtt gattcttttt tgatgcattg tgtcgatggt
    3101  tctttaaccg gagacgtgtt gcatttcgac gaagctctca tggcccatgc
    3151  tggtatggtg tacttttgcg ctcagatagc tggtgctaaa cgatgtatct
    3201  gtcaaggaga tcagaatcaa atttctttca agcctagggt atctcaagtt
    3251  gatttgaggt tttctagtct ggtcggaaag tttgacattg ttacagaaaa
    3301  aagagaaact tacagaagtc cagcagatgt ggctgccgta ttgaacaagt
    3351  actatactgg agatgtcaga acacataacg cgactgctaa ttcgatgacg
    3401  gtgaggaaga ttgtgtctaa agaacaggtt tctttgaagc ctggtgctca
    3451  gtacataact ttccttcagt ctgagaagaa ggagttggta aatttgttgg
    3501  cattgaggaa agtggcagct aaagtgagta cagtacacga gtcgcaagga
    3551  gagacattca aagatgtagt cctagtcagg acgaaaccta cggatgactc
    3601  aatcgctaga ggtcgggagt acttaatcgt ggcattgtcg cgtcacacac
    3651  aatcacttgt gtatgaaact gtgaaagagg acgatgtaag caaagagatc
    3701  agggaaagtg ccgcgcttac gaaggcggct ttggcaagat tttttgttac
    3751  tgagaccgtc ttatgacggt ttcggtctag gtttgatgtc tttagacatc
    3801  atgaagggcc ttgcgccgtt ccagattcag gtacgattac ggacttggag
    3851  atgtggtacg acgctttgtt tccgggaaat tcgttaagag actcaagcct
    3901  agacgggtat ttggtggcaa cgactgattg caatttgcga ttagacaatg
    3951  ttacgatcaa aagtggaaac tggaaagaca agtttgctga aaaagaaacg
    4001  tttctgaaac cggttattcg tactgctatg cctgacaaaa ggaagactac
    4051  tcagttggag agtttgttag cattgcagaa aaggaaccaa gcggcacccg
    4101  atctacaaga aaatgtgcac gcgacagttc taatcgaaga gacgatgaag
    4151  aagctgaaat ctgttgtcta cgatgtggga aaaattcggg ctgatcctat
    4201  tgtcaataga gctcaaatgg agagatggtg gagaaatcaa agcacagcgg
    4251  tacaggctaa ggtagtagca gatgtgagag agttacatga aatagactat
    4301  tcgtcttaca tgtatatgat caaatctgac gtgaaaccta agactgattt
    4351  aacaccgcaa tttgaatact cagctctaca gactgttgtg tatcacgaga
    4401  agttgatcaa ctcgttgttc ggtccaattt tcaaagaaat taatgaacgc
    4451  aagttggatg ctatgcaacc acattttgtg ttcaacacga gaatgacatc
    4501  gagtgattta aacgatcgag tgaagttctt aaatacggaa gcggcttacg
    4551  actttgttga gatagacatg tctaaattcg acaagtcggc aaatcgcttc
    4601  catttacaac tgcagctgga gatttacagg ttatttgggc tggatgagtg
    4651  ggcggccttc ctttgggagg tgtcgcacac tcaaactact gtgagagata
    4701  ttcaaaatgg tatgatggcg catatttggt accaacaaaa gagtggagat
    4751  gctgatactt ataatgcaaa ttcagataga acactgtgtg cactcttgtc
    4801  tgaattacca ttggagaaag cagtcatggt tacatatgga ggagatgact
    4851  cactgattgc gtttcctaga ggaacgcagt ttgttgatcc gtgtccaaag
    4901  ttggctacta agtggaattt cgagtgcaag atttttaagt acgatgtccc
    4951  aatgttttgt gggaagttct tgcttaagac gtcatcgtgt tacgagttcg
    5001  tgccagatcc ggtaaaagtt ctgacgaagt tggggaaaaa gagtataaag
    5051  gatgtgcaac atttagccga gatctacatc tcgctgaatg attccaatag
    5101  agctcttggg aactacatgg tggtatccaa actgtccgag tctgtttcag
    5151  accggtattt gtacaaaggt gattctgttc atgcgctttg tgcgctatgg
    5201  aagcatatta agagttttac agctctgtgt acattattcc gagacgaaaa
    5251  cgataaggaa ttgaacccgg ctaaggttga ttggaagaag gcacagagag
    5301  ctgtgtcaaa cttttacgac tggtaatatg gaagacaagt cattggtcac
    5351  cttgaagaag aagactttcg aagtctcaaa attctcaaat ctaggggcca
    5401  ttgaattgtt tgtggacggt aggaggaaga gaccgaagta ttttcacaga
    5451  agaagagaaa ctgtcctaaa tcatgttggt gggaagaaga gtgaacacaa
    5501  gttagacgtt tttgaccaaa gggattacaa aatgattaaa tcttacgcgt
    5551  ttctaaaggt agtaggtgta caactagttg taacatcaca tctacctgca
    5601  gatacgcctg ggttcattca aatcgatctg ttggattcga gacttactga
    5651  gaaaagaaag agaggaaaga ctattcagag attcaaagct cgagcttgcg
    5701  ataactgttc agttgcgcag tacaaggttg aatacagtat ttccacacag
    5751  gagaacgtac ttgatgtctg gaaggtgggt tgtatttctg agggcgttcc
    5801  ggtctgtgac ggtacatacc ctttcagtat cgaagtgtcg ctaatatggg
    5851  ttgctactga ttcgactagg cgcctcaatg tggaagaact gaacagttcg
    5901  gattacattg aaggcgattt taccgatcaa gaggttttcg gtgagttcat
    5951  gtctttgaaa caagtggaga tgaagacgat tgaggcgaag tacgatggtc
    6001  cttacagacc agctactact agacctaagt cattattgtc aagtgaagat
    6051  gttaagagag cgtctaataa gaaaaactcg tcttaatgca taaagaaatt
    6101  tattgtcaat atgacgtgtg tactcaaggg ttgtgtgaat gaagtcactg
    6151  ttcttggtca cgagacgtgt agtatcggtc atgctaacaa attgcgaaag
    6201  caagttgctg acatggttgg tgtcacacgt aggtgtgcgg aaaataattg
    6251  tggatggttt gtctgtgttg ttatcaatga ttttactttt gatgtgtata
    6301  attgttgtgg ccgtagtcac cttgaaaagt gtcgtaaacg tgttgaaaca
    6351  agaaatcgag aaatttggaa acaaattcga cgaaatcaag ctgaaaacat
    6401  gtctgcgaca gctaaaaagt ctcataattc gaagacctct aagaagaaat
    6451  tcaaagagga cagagaattt gggacaccaa aaagattttt aagagatgat
    6501  gttcctttcg ggattgatcg tttgtttgct ttttgatttt attttatatt
    6551  gttatctgtt tctgtgtata gactgtttga gattggcgct tggccgactc
    6601  attgtcttac cataggggaa cggactttgt ttgtgttgtt attttatttg
    6651  tattttatta aaattctcaa tgatctgaaa aggcctcgag gctaagagat
    6701  tattgggggg tgagtaagta cttttaaagt gatgatggtt acaaaggcaa
    6751  aaggggtaaa acccctcgcc tacgtaagcg ttattacgcc c