!!NA_SEQUENCE 1.0
ID   AF454454   standard; RNA; VRL; 9381 BP.
XX
AC   AF454454;
XX
SV   AF454454.1
XX
DT   28-DEC-2001 (Rel. 70, Created)
DT   03-MAY-2002 (Rel. 71, Last updated, Version 2)
XX
DE   Wheat streak mosaic virus isolate Czech, complete genome.
XX
KW   .
XX
OS   Wheat streak mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Tritimovirus.
XX
RN   [1]
RP   1-9381
RX   MEDLINE; 21904451.
RX   PUBMED; 11907340.
RA   Rabenstein F., Seifers D.L., Schubert J., French R., Stenger D.C.;
RT   "Phylogenetic relationships, strain diversity and biogeography of
RT   tritimoviruses";
RL   J. Gen. Virol. 83(Pt 4):895-906(2002).
XX
RN   [2]
RP   1-9381
RA   Rabenstein F., Seifers D.L., Schubert J., French R., Stenger D.C.;
RT   ;
RL   Submitted (03-DEC-2001) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS, University of Nebraska, 344 Keim Hall, Lincoln, NE 68583, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .9381
FT                   /db_xref="taxon:31741"
FT                   /organism="Wheat streak mosaic virus"
FT                   /isolate="Czech"
FT   CDS             131. .9235
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /protein_id="AAL51040.1"
FT                   /translation="MAAANCLLGDFGRQGVVANDPYVQCRARTLIFLSTEEEVDVVVNH
FT                   HGPGSIFWSKEGILTQTAKNLYKATAYGLGYDLAANVFVCGKCRSSCTQYRYFIEDHFA
FT                   CDKLVEKNCAYIKDDKYVKVVEAFPIMPSYATPGQEARIIQWMNKTSQCLADHCIQRTR
FT                   EITFTNSKTQEEETRVKDCSIEVFYDDFDETHAVIEHAHRKNPIHEYKEKQLRMTSNNI
FT                   AALVDQVTRMMHSKGKTVEIIGSKGHKKFAKIPLKHTMGYPKRDWDAMKDIPEDFRGFI
FT                   TTYSGVIQYTRKVQDHEVTLGWSGVLLSEMDVPDGYQEDCVDGLFIVMGRCAHGRIQNA
FT                   LKPKCTHGLRWYCEPAVNKVIPKHHEVCNSNCASYLEALPRKVSRVWQSMFDIHNLRCD
FT                   LCRAEWKTRTASEHLQLLQKSVEHYMQTYPDSDVTLFKAFLQALGPDEEVETRQLKPNN
FT                   TLQLVDVWRTMKNTINIPNRIIYMGMFTDNYGNFDFFPNTSMPELFAMHMQPVQHKMLD
FT                   DGTIETNFRFVDLEGKIQTSIESLYPKFDSTYWNEQARKVHRIQPLTDCSMEINGESKP
FT                   ICHWEGNVPLYNPIIRATPGQLPFGVTTHLLSVNDRSGRFHYVPKNGYCYMYIFACAMI
FT                   FCGNSNRSTVDAFVRQVCEDLGPWPTFGEVLRQLDWMATFYGCYDALVPVILVDHTRKT
FT                   MHVPTPYGMKQSGMHTIRVNTVLELITLDTMASGAMKDYKIGGFQDTVLGIQACVKSRK
FT                   EFVRKINKDAEWLVDMFINPSTLFVLGGLIEVHQVILADVENSFDKSAALLNLRQIALK
FT                   LGPHLESKQRVRQYMELMIQHRASVEAIIPSQHMKAEMMQYIDALQRSILEEQVIIEMD
FT                   RVGGKEKMLVEQDLSHAECAYNEFFNSIGYLNFHGTVLRLTYSGPGRKVGEVLESLKDN
FT                   WLTRYLRGPKQPRDYKGSSLRIWRKVTHLCGNAYRWVFYNMAANVLQVILIGLSTVFGA
FT                   YLLKKILKMLQWEKEQESTELVEYQGKREEAWITRVMAVLYIIASLFSVDFSSALYSNL
FT                   VKFRTIFDILKFNCEYQSGIFESLKNQLGNIPAFHEVHLYDHEATQVAVPPAILTFERW
FT                   FETRITSGQQGYAPLDGSHVSLTMTKDTVGEIATQVQTHKAKEFLIIGHVGCGKSTAFP
FT                   ATLSRNGRVMICEPTRVLVTNLQDSMLATKNLSISAMMRNHRVMTASNITVTTYGYALH
FT                   YLYNNSHNLAEYDYILFDEVHQTSAEMLVFYNWLKSTTWEGKLIKLTATNNTVNGDMQT
FT                   QQALDVKTWPVMDHRTFMQEQGRGTAHDASTLGDVIIVFLTSFREIDESADILSKNPKI
FT                   GVIKADSRHLRNKVSLMDDVEALRAEKKYILATNILQNGVNLHADVVVDFGFKIVPAID
FT                   SDNRMITVKRQLINKSDRIQRLGRVGRMKMGYARKIGNEIDASFALDEVTATEAALLAF
FT                   GLGVAPVLQNVDQHTFGKITAEQVRTAARFEMQLSYMVWMINRDGTMATRLYEQFKSLL
FT                   LTPGNTSLAPYYETLVDTHRFRTIGQYATLGYMRTDEKHHLVLPFHHNDVSVEFAERIG
FT                   EAYMASQVPTSIKLRVPAVNHREVAMKMSANPEDVGTILYMVEQALISEKTKLENLTQA
FT                   FQQQQSTYCSVLIPNFNVAGRLTQAMDRIRKNVSVLQHQKTALEKAAVTYDYTKLVELL
FT                   DENPSIASHVSYQAGPAKFIDEFILEKRDYGWLPYLAVGTACAIAGTTLVMMYYRRMKR
FT                   SVKFEGKAERNRSAKRQSARDQKMERGNEYTYYDAGDTLYNGVQENMNHAPDWTDRIKK
FT                   KTNAYAMQFGREVPKTETQRSSQYWHFYGFDPKMYDSVEFKDIAANFSVHQDAKAMDLQ
FT                   KAFTEMVENRWDDDDFFDEKIPKRVLAIFRKGDKVREVALAPHKPNQVNKRGLPVGHAD
FT                   HRGEWRQTQPSFEKEVSYENKSTFEGARSLDHIHQNQVILVEDNQQLNGLIVGNILLAP
FT                   YHFTRGMRNREEKETRMLTQFGTYNLGKLTNKHVTKFTMMDLVALTLPPTFQARRKLKC
FT                   FRPPREGERAMLVTMQYEKTGWVAKQSAETTITPFGDRHDGLWKHRISTGPGDCGSAIV
FT                   AVADLKVVGFHNLGGKGENYFTPITIEVMDFLAEKSVTPLVPWKFSDEQVDLCGLIAAN
FT                   GADKYPFTKTISDLVSWQSLQMTKYCGENFKAIAYAPNRMSKRHVITGKRPEFIKFLDS
FT                   HPKWNTLVTPFLNEFQPSVLTHEAYYKDVLKYNKDIIVGGTDEVCFAKAVVATIGILEI
FT                   AGFSKGQFQPIFDGCKIFNDLNLDAAMGALYSGKKAAYFDGATSDEINEFFELSAAKLL
FT                   SNGHGVWSGLLKAELRPKAKVVANKTRTFTSAPIDILMGAKAVVDEFNKFFYTKHLRGP
FT                   WTVGINKFNGGWDLLAKNLMVHEWFIDADGSQFDSSITPLLMNAILNIRQYFMAEDDEA
FT                   EQMLANLYTQIINTCILIEDGTIVQKFRGNNSGQPSTVVDNTMCLIIAMEYCRMRVEKD
FT                   HGHSMRILYVCNGDDLLINADTKDKDFIQQFFADYMRELELNYSFDEAYRSIEEVEYMS
FT                   HTFMKRGSMYIPKLKRERIVAILEWQRSKEPKAIQSAIIAAYVEAFGYDDFTEMIEELA
FT                   REVSAVWPDFKLPSREEVENLYLTGNRTDLGEEIKECGEQYCVYESSEAATDAVLAAAN
FT                   AGSGSAPSSGSTQSSLSASTASGSGSSPSGSGSGAAGGSGSGSAQTQSSNVSVMAGLDT
FT                   GAKTGQGSGSKGTGGSFVSNPVRTGGRATDVQDQTPGLVFPAPKITTKAIYMPKTVRDK
FT                   IKPEMINNMIKYQPRAELIDNRYATTEQLNTWIKEASEGLDVTEDVFINTLLPGWVYHC
FT                   IINTTSPENRALGTWRVVNNAGKDNEQQLEFKIEPMYKAAKPSLRAIMRHFGEGARVMI
FT                   EESVRIGKPIIPRGFDKAGVLSINNIVAACDFIMRGADDTPNFVQVQNSVAVNRLRGIQ
FT                   NKLFAQARLSAGTNEDNSRHDADDVRENTHSFNGVNALA"
XX
SQ   Sequence 9381 BP; 2941 A; 1904 C; 2322 G; 2214 T; 0 other;

  AF454454  Length: 9381  May 8, 2002 15:56  Type: N  Check: 8521  ..
       1  aaattaaacc aacccaaatc gatctgacaa cgaacaaaac gaactcacag
      51  cattcttaag ctcaagttca acaaagttca ttgcgcagaa agcaattcgt
     101  tcattgtgag ctctcgcata gagataagca atggcagcag cgaattgttt
     151  gctcggtgac ttcggaaggc agggggtcgt cgctaatgac ccatatgtac
     201  agtgcagggc gcgcacgctg attttcttaa gcactgagga ggaggttgat
     251  gtggtggtta accaccatgg accaggaagc attttctggt caaaagaagg
     301  tatcttaacc cagacggcta agaacctcta caaagctact gcgtacggct
     351  taggctacga tcttgcagcg aacgttttcg tttgcgggaa gtgtaggtca
     401  agttgcactc agtacaggta cttcattgaa gatcattttg cttgtgacaa
     451  gcttgtggag aagaactgtg cgtacatcaa ggatgataag tacgtgaagg
     501  tcgtggaggc atttccaatt atgccatcat acgccacacc agggcaggaa
     551  gcacgcatca tacagtggat gaacaaaaca agccaatgcc ttgctgatca
     601  ctgcatccaa cgcacgcgtg agatcacctt caccaactca aaaacccaag
     651  aggaagaaac tcgcgtaaag gattgcagta ttgaggtgtt ttatgatgat
     701  tttgatgaaa cacatgcagt tattgagcat gctcatcgta agaatccgat
     751  ccacgagtac aaagagaagc agctacgcat gacatcaaac aacatagctg
     801  cgttggtgga tcaagtgaca cggatgatgc attccaaggg caaaacagtg
     851  gaaatcatag gaagcaaagg gcacaagaaa tttgctaaaa ttccactgaa
     901  gcatacaatg gggtacccaa agagagattg ggatgcaatg aaagacatac
     951  cagaggactt cagaggcttc atcacaacct acagcggtgt tatacaatac
    1001  acacgtaaag tgcaggatca tgaggtgacg ctcggatgga gtggtgtcct
    1051  ccttagtgaa atggatgtgc cagatggcta ccaggaggat tgtgtggatg
    1101  gcctattcat tgttatggga agatgtgcac atggacgcat tcagaacgca
    1151  ctgaagccga aatgcacgca tggacttaga tggtattgcg aaccagctgt
    1201  gaacaaagtg attccaaaac atcatgaagt gtgcaacagt aactgcgcaa
    1251  gttatctgga agcattacca agaaaggtta gtcgtgtgtg gcaatcaatg
    1301  ttcgacatac acaacctgag gtgcgatttg tgcagagcag agtggaagac
    1351  gcgaactgct tcagagcatt tgcagttgct acagaaatct gtagagcatt
    1401  acatgcagac gtatccagac agcgatgtaa cattgttcaa ggcgttttta
    1451  caagcacttg gaccagatga ggaagtcgaa acacgtcaac ttaaacctaa
    1501  caatacattg caacttgtgg atgtgtggcg gacaatgaag aacacgataa
    1551  acatcccaaa tagaatcatc tacatgggca tgttcacaga caattatgga
    1601  aatttcgatt tcttcccaaa tacatcaatg cctgaactat tcgcaatgca
    1651  catgcaacca gttcaacaca agatgctaga tgatggaaca attgaaacga
    1701  attttagatt cgttgattta gaagggaaaa tccagacgag catcgaaagt
    1751  ttatacccga aattcgacag cacatactgg aacgaacaag cacgcaaagt
    1801  ccacagaatc caaccgttga cagattgctc catggaaatt aacggcgaat
    1851  ctaagcccat ttgtcattgg gaggggaatg ttccgttgta caatcccata
    1901  atccgtgcaa caccagggca actaccattt ggagtaacta cgcacttgct
    1951  gagtgtgaac gacaggagcg gaagatttca ttatgtgccg aagaacggat
    2001  attgctacat gtacatcttt gcatgcgcaa tgatcttctg tggtaatagc
    2051  aaccgttcga cagttgatgc atttgtccgg caagtttgcg aagatctggg
    2101  tccctggcct acatttggtg aggtattgag acaacttgac tggatggcaa
    2151  ccttttatgg gtgttatgat gcactggtgc cagtaatctt agtggatcac
    2201  acgaggaaga ctatgcacgt gccaacgcca tatggcatga aacaatcagg
    2251  aatgcacacc ataagggtta acacagtact ggaactgata accctcgaca
    2301  ccatggccag cggagcaatg aaggattaca agattggcgg attccaagac
    2351  actgttctcg gcatacaagc gtgtgtcaag agcaggaagg aatttgtgcg
    2401  taaaatcaac aaagatgctg aatggttagt ggatatgttc attaatcctt
    2451  cgacactctt tgtgttaggg ggtctaattg aagttcacca agttattctc
    2501  gcagatgttg agaattcatt cgataaatca gcagctctac tgaacttgcg
    2551  ccagatagcc ctaaagctcg gacctcactt ggaatcgaaa cagcgcgtgc
    2601  gtcaatacat ggagttaatg attcaacacc gagcatcagt tgaagcaata
    2651  attccatcac aacacatgaa agctgagatg atgcaataca tcgacgcgct
    2701  acaacgctca attcttgaag agcaagtgat catagagatg gatcgagttg
    2751  gaggaaagga aaaaatgctc gtcgagcaag atctttcaca cgcagagtgt
    2801  gcgtacaacg agttcttcaa ctccattggt tacttaaact ttcatggaac
    2851  cgttttacga ctcacatatt ctggtcccgg aagaaaggtt ggagaagtgc
    2901  tagagagttt aaaagacaac tggttgacac gctatctccg aggaccgaag
    2951  cagccgagag attacaaagg gagttccttg aggatctgga ggaaggttac
    3001  tcacctttgc ggaaacgctt acaggtgggt gttttacaac atggccgcga
    3051  acgtcttgca agttatactc ataggccttt ctaccgtttt cggagcctat
    3101  ttattaaaga agatcttaaa aatgcttcaa tgggagaagg agcaagaaag
    3151  caccgaattg gttgaatacc aagggaagcg agaggaagca tggataacac
    3201  gagtaatggc tgtattgtat ataatagctt cactcttttc tgtagacttt
    3251  agttctgctt tatattcgaa tttggttaaa tttagaacca tatttgatat
    3301  tttaaagttt aactgtgaat accagagtgg aatatttgaa agtttgaaaa
    3351  atcaactcgg caacatccca gcatttcatg aagtgcattt gtacgaccac
    3401  gaggcaacac aagtagcagt tccaccagcc attttaacgt ttgaacgatg
    3451  gtttgaaact cgaatcactt ctggccaaca agggtacgca ccattagatg
    3501  gtagccatgt aagcttaaca atgacaaaag acacagtcgg tgaaatcgct
    3551  acacaagtgc agacacacaa ggcgaaggaa tttctcatca taggacatgt
    3601  tgggtgtgga aaatccacag cctttccagc aacgctctcc cggaatgggc
    3651  gtgtcatgat ttgcgaacct acccgcgtgc tggtaacaaa cttgcaagat
    3701  tcaatgttag caacgaagaa tttaagtatc agcgccatga tgaggaacca
    3751  tcgggttatg acggcgtcga atataactgt aaccacgtat gggtatgcac
    3801  tccattattt gtacaacaac tcacacaacc ttgcagagta tgactacatt
    3851  ctttttgacg aagtgcatca aacctcggca gaaatgctag tgttttacaa
    3901  ctggcttaag agcacaacgt gggagggcaa actcattaag ttaacagcta
    3951  caaacaacac cgtcaatgga gacatgcaaa cacagcaggc acttgatgtc
    4001  aaaacatggc cagttatgga ccacaggaca ttcatgcagg agcaaggccg
    4051  gggaactgcc cacgatgcat ccactcttgg tgatgttatc atagtgttct
    4101  taacttcgtt ccgcgagatt gacgaatctg ccgacatttt gagcaaaaac
    4151  ccaaagattg gagtcataaa ggcagatagt cgccacttgc gaaacaaagt
    4201  tagcttaatg gatgatgttg aagcactccg agctgaaaag aaatacatcc
    4251  ttgcaacgaa catccttcaa aacggtgtga atttgcacgc agacgttgta
    4301  gttgattttg gtttcaagat tgtgccagca attgacagcg acaatcgaat
    4351  gattacagtt aagcgccaac tgatcaacaa atcagaccga attcagagat
    4401  tgggacgagt aggccggatg aagatgggat acgcaaggaa aatcggaaat
    4451  gagatagacg catcgttcgc cttggatgaa gtgacagcta cggaagctgc
    4501  cttgttggca tttggactag gtgttgctcc agtgttgcaa aatgttgatc
    4551  aacacacatt cggaaagatt acagcagagc aagttcgaac agcagcacga
    4601  tttgagatgc aattgtcata catggtgtgg atgattaata gagatggaac
    4651  catggccaca cggttatatg aacaatttaa gtcactcttg ctaacaccag
    4701  gaaacacgag tttggcaccg tattacgaga cgcttgtaga cactcacagg
    4751  ttcagaacta ttggtcaata tgcaactctg ggatacatgc gcacagatga
    4801  gaaacaccat ttggttctcc catttcacca taatgatgtt agcgttgaat
    4851  ttgcagagag gattggtgaa gcgtatatgg cttctcaagt cccaacatca
    4901  atcaagttgc gtgtgccagc agttaaccac agagaggtgg ctatgaagat
    4951  gtcagcaaat cctgaagatg tgggaaccat actgtacatg gttgagcaag
    5001  cactgattag cgagaagaca aaactggaaa atctcactca ggcgttccag
    5051  caacaacagt caacatattg cagtgtgctc attcctaatt tcaacgttgc
    5101  tggtagactg acacaggcga tggatcgcat tagaaagaat gtctcagtgc
    5151  tacaacacca gaaaacagct cttgagaagg cggcagtgac atatgattac
    5201  acaaagttag ttgagctcct tgatgaaaat ccaagcatag cttctcatgt
    5251  gtcataccaa gctgggccag caaagttcat tgatgaattc atattggaga
    5301  agcgtgatta tggatggctt ccatatcttg cggtgggaac tgcatgtgcg
    5351  atagctggta caacacttgt gatgatgtac taccgtcgca tgaagcgcag
    5401  tgttaaattc gagggcaagg cagaacgcaa caggagcgcg aagcgacagt
    5451  cagccagaga ccagaagatg gagcgtggta atgaatacac atactatgac
    5501  gccggcgaca ctttgtacaa tggggttcaa gagaatatga atcatgcacc
    5551  agattggact gaccgaatca agaagaaaac caatgcatat gcaatgcaat
    5601  ttggtaggga agtgccaaag accgaaacac agcgatcttc ccaatattgg
    5651  catttctatg gatttgatcc aaagatgtac gattcggttg aattcaagga
    5701  tatagccgct aacttttcag tgcatcagga tgccaaggca atggatctgc
    5751  agaaagcctt cacagaaatg gtggagaatc gttgggatga tgatgatttc
    5801  tttgacgaga aaataccgaa gcgagttcta gccatcttca gaaaagggga
    5851  caaagttcgt gaggtcgcat tggcacctca caagccaaac caagttaaca
    5901  agcgtgggct acctgttggg catgctgacc acagaggaga atggcgacaa
    5951  acacaaccat cgtttgagaa agaagtgtca tacgagaaca aatcaacctt
    6001  tgaaggggca cgctcacttg atcatatcca tcagaatcag gttattcttg
    6051  ttgaggacaa ccaacagttg aatgggttaa tagtcggaaa tatactcttg
    6101  gcgccgtatc acttcacgcg aggtatgagg aacagagaag agaaggaaac
    6151  acgcatgtta acacaatttg gaacatacaa tcttggaaaa ctcaccaaca
    6201  agcatgtcac aaagtttacg atgatggatt tggttgcatt aaccttacct
    6251  ccgactttcc aagcaagacg gaagcttaag tgtttcagac caccacggga
    6301  aggagaacga gcaatgttag taaccatgca atacgagaaa actggatggg
    6351  tcgctaagca atcagcggaa acaacaatca caccattcgg tgatcgacat
    6401  gatggtttgt ggaagcacag aatctcgaca ggaccaggag attgtggaag
    6451  cgctatagtg gcagtagcag acttgaaggt tgttgggttc cataatcttg
    6501  gagggaaagg cgagaattat ttcacgccga taaccattga agtcatggat
    6551  ttcctagctg aaaagtccgt aacaccactt gttccatgga aattttcaga
    6601  tgagcaagtt gatctgtgcg gtttaattgc ggccaatgga gcagacaaat
    6651  acccatttac caaaactata agcgatttgg ttagctggca aagccttcag
    6701  atgacaaaat attgtgggga gaatttcaag gctattgctt atgctccaaa
    6751  ccgaatgtca aagagacacg tcatcacagg aaagaggccc gagttcatca
    6801  agtttctaga ctcccacccg aaatggaaca ctctggtgac acctttcctg
    6851  aacgaattcc aaccatcagt tctgacacat gaagcatatt acaaggatgt
    6901  actgaagtac aacaaggaca taattgttgg aggaactgat gaagtgtgct
    6951  ttgcgaaagc agtggttgct accattggaa ttctcgaaat agccgggttt
    7001  tcaaagggtc aattccagcc catctttgac ggatgcaaaa ttttcaacga
    7051  tttgaatctg gatgctgcaa tgggagctct atattcaggg aagaaggctg
    7101  catactttga cggagcaaca agtgatgaaa tcaacgagtt ctttgagttg
    7151  agcgcagcga agttgctcag taatggacac ggagtgtggt ctggtttgct
    7201  aaaggctgag ttgagaccga aggctaaagt tgtggcaaac aagacgagaa
    7251  cattcacatc agcaccgatt gacatactta tgggcgccaa ggctgtggtt
    7301  gatgagttta acaagttttt ctacacaaaa cacctgcgtg ggccatggac
    7351  agtaggcatc aacaaattca atggtgggtg ggatttgcta gctaaaaact
    7401  tgatggtgca cgagtggttc atagatgctg atggctctca atttgatagc
    7451  tcaatcactc cgcttttgat gaatgcaatt ttgaacataa ggcagtactt
    7501  catggcagag gacgatgagg ctgagcagat gttggcaaat ttgtacacgc
    7551  agataataaa cacatgcatc ttaattgaag atggtacgat tgtgcaaaag
    7601  tttcgaggta acaacagtgg tcaaccaagc acagtcgttg acaacacgat
    7651  gtgcctgatc atagcaatgg agtattgcag aatgcgtgtg gagaaagatc
    7701  acggacacag catgaggata ctatatgtgt gcaatggaga tgatctactt
    7751  atcaatgccg acacaaagga taaagacttc atacagcagt tctttgccga
    7801  ctacatgcgc gagttggagc tgaattattc atttgatgaa gcgtatcgta
    7851  gcatcgagga ggttgagtac atgtcacaca cattcatgaa gcgaggctca
    7901  atgtacatac caaagttgaa gcgcgaacgc attgtggcaa ttctagagtg
    7951  gcagagaagc aaggaaccaa aggctattca gagtgccatc attgcagcat
    8001  atgtggaagc ttttggttat gatgatttca cggaaatgat tgaagagctc
    8051  gcacgggagg tctcagcagt atggccagat ttcaagttgc cctcacggga
    8101  ggaagttgaa aacttatacc taactgggaa ccgaactgat ctgggagagg
    8151  aaatcaaaga gtgtggagaa cagtactgcg tgtacgaatc aagtgaggca
    8201  gcaactgatg ctgtcctggc agcagcaaat gccggaagtg gcagtgcacc
    8251  gagcagtgga agtacgcagt caagtctgag tgcaagcacg gcaagcggat
    8301  caggaagctc accatcaggg tcaggttctg gagcagcggg tggatcaggt
    8351  tcaggatcag cacaaacaca atctagcaac gtgtcggtca tggcaggcct
    8401  cgacacggga gctaagactg gtcaagggtc aggatcaaaa ggaacaggtg
    8451  gttcattcgt ttcgaatcct gtgcgaactg gaggtcgagc aacggatgtg
    8501  caagatcaga caccaggcct tgtgtttcca gcaccaaaaa tcacaacaaa
    8551  ggccatatac atgccgaaaa ccgtacgcga taagataaag cctgaaatga
    8601  taaataacat gattaaatac caaccgcgtg cagaactcat cgataatagg
    8651  tatgccacaa ctgagcaact caatacctgg atcaaagaag catctgaagg
    8701  gcttgatgtt acagaggatg tgttcattaa caccttgctt cctggatggg
    8751  tttatcactg cataattaat acaacgagcc cagagaacag agcactagga
    8801  acttggcgtg ttgtgaataa tgcaggaaag gacaatgagc agcaactcga
    8851  atttaagatc gaaccgatgt acaaagctgc gaagccatca cttcgagcta
    8901  ttatgcggca ttttggcgag ggagctcggg tgatgatcga ggagagcgtt
    8951  cgaattggga aacctattat accaagaggt tttgacaaag ccggtgtgct
    9001  aagcatcaac aatattgtgg cagcgtgtga ttttatcatg cgtggggcag
    9051  atgacacacc aaacttcgtg caagtgcaaa acagcgttgc agtgaacagg
    9101  ctacgcggaa tacagaataa gctgtttgca caagcacgac tgagtgcggg
    9151  tactaatgag gacaactcac gtcacgacgc agatgatgtg agggagaaca
    9201  cgcacagttt caatggtgta aacgcgcttg cgtgagcaca gtagaaacta
    9251  caaatccatg agtaccaggg tttgagcgga ataacgctgc gtttcgttaa
    9301  cccttcgttg ttactaggtg tgtacttctc cacgagaggc gtgcattctt
    9351  ggtagccatg tgtgggttag ggcgacgcta c