!!NA_SEQUENCE 1.0
ID   AF454455   standard; RNA; VRL; 9384 BP.
XX
AC   AF454455;
XX
SV   AF454455.1
XX
DT   28-DEC-2001 (Rel. 70, Created)
DT   03-MAY-2002 (Rel. 71, Last updated, Version 2)
XX
DE   Wheat streak mosaic virus isolate Turkey 1, complete genome.
XX
KW   .
XX
OS   Wheat streak mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Tritimovirus.
XX
RN   [1]
RP   1-9384
RX   MEDLINE; 21904451.
RX   PUBMED; 11907340.
RA   Rabenstein F., Seifers D.L., Schubert J., French R., Stenger D.C.;
RT   "Phylogenetic relationships, strain diversity and biogeography of
RT   tritimoviruses";
RL   J. Gen. Virol. 83(Pt 4):895-906(2002).
XX
RN   [2]
RP   1-9384
RA   Rabenstein F., Seifers D.L., Schubert J., French R., Stenger D.C.;
RT   ;
RL   Submitted (03-DEC-2001) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS, University of Nebraska, 344 Keim Hall, Lincoln, NE 68583, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .9384
FT                   /db_xref="taxon:31741"
FT                   /organism="Wheat streak mosaic virus"
FT                   /isolate="Turkey 1"
FT   CDS             131. .9238
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /protein_id="AAL51041.1"
FT                   /translation="MATANCLLGDFGRQGVVANDPYVQCRARTLIFLSTEEEVDVVVNH
FT                   HGPGSIFWSKEGILTQTAKNLYKATAYGLGYDLAANVFVCGKCRSSCTQYKYFIEDHFA
FT                   CDKLVEKNCAYIKDDKYVKVVEAFPIMPSYATPGQETRIIQWMNKTSQCLADHCIQRTR
FT                   EITFTNSKTQEEETRVKDCSLEVFYDDFDEAHAVIEHAHRKNPVHEYKEKQLRMTSNNI
FT                   AALVDQVTRMMHSKGKTVEIVGSKGHKKFAKIPLKHTMGYPKRDWDATKDIPEDFRGFI
FT                   TTYSGVIQYTRKVQDHEVTLGWSGVLLSEMDVPDGYQEDCVDGLFIVMGRCAHGRIQNA
FT                   LKPKCTHGFRWYGDQAVNKVIPKYHDVCNNNCASYLEALPRKVSRVWQSMFDIHNLRCD
FT                   QCRTEWKMRTASEHLQLLQKSVEHYMQTYPDSDVTLFKAFLQALGPDEEVEARQLKPNN
FT                   TLQLVDVWRTMKNTINIPNRIIYMGMFTDNYGNFDFFPNTSMPELFAMHMQPVQHKMLE
FT                   DGTIETNFRFVDLEGKIQTSIESLYPTFDSTYWNEQARRVHRIQPLADCSMEINGESKP
FT                   ICHWEGNVPLYNPIIRATPGQLPFGVTTHLLSVNDRSGRFHYVPKNGYCYMYIFACAMI
FT                   FCSNSNRSTVDAFVRQVCEDLGPWPTFGDVLRQLAWMATFYGCYDALVPVILVDHTRKT
FT                   MHVPTPYGIKQSGMHTIRVNTVLELITLDTMASGAMKEYKIGGFQETVLSIQACVKSRK
FT                   EFVRKINKDAEWLVDMFINPSTLFVLGGLIEVHQVILADVENSFDKSAALLNLRQIALK
FT                   LGPHLESKQRVRQYMELMIQHRASVEAIIPSQHMKAEMMQYIDALQRSILEEQVIIEMD
FT                   RVGGKEKMLVEQDLSHAECAYNEFFNSIGYLNFHGTVLRLTYSGPGRKVGEVLESLRDN
FT                   WLTRYLRGPKQPRDYKGSSLRIWRKVTHLCGNAYRWVFYNMAANVLQVILIGLSTVFGA
FT                   YLLKKILKMLQWEKEQESTELVEYQGKREEAWITRVMAVLYIIASLFSVDFSSALYSNL
FT                   VKFRTIFDILKFNCEYQSGIFESLKNQLGNIPAFHEVHLYDHEATQVAVPPAILTFERW
FT                   FETRITSGQQGYAPLDGSHVSLTMTKDTVGEISTQVQTHKAKEFLIIGHVGCGKSTAFP
FT                   ATLSRNGRVMICEPTRVLVTNLQDSMLATRNLSISAMMRNHRVMTASNITVTTYGYALH
FT                   YLYNNSHNLSEYDYILFDEVHQTSAEMLVFYNWLKSTTWEGKLIKLTATNNTVNGDMQT
FT                   QQALDVKTWPVMDHRTFMQEQGRGTAHDASTLGDVIIVFLTSFREIDESADILSKNSKI
FT                   GVIKADSRHLRNKVSLMDDVEALRAEKKYILATNILQNGVNLHADVVVDFGFKIVPAID
FT                   SDNRMITVKRQLINKSDRIQRLGRVGRMKMGYARKIGNEIDASFALDEVTATEAALLAF
FT                   GLGVAPVLQNVDQHTFGKITAEQVRTAARFEMQLSYMVWMVNRDGTMATRLYEQFKSLL
FT                   LTPGNTSLAPYYETLVDTHRFRTIGQYATLGYMRTDEKHHLVLPFHHNDVSVEFAERIG
FT                   EAYMASQVPTSIKLRVPAVNHREVAMKMSANPEDVGTILYMVEQALISEKTKLENLTQA
FT                   FQQQQSTYCSVLIPNFNVAGRLTQAMDRIRKNVSVLQHQKTALEKAAVTYDYTKLVELL
FT                   DENPSIASHVSYQAGPAKFIDEFILEKRDYGWLPYLAVGTACAIAGTTLVMMYYRRMKR
FT                   SVKFEGKAARNRSAKRQSARDQKMERGNEYTYYDAGDTLYNGVQENMNHAPDWTDRIKK
FT                   KTHAYAMQFGREVPKTETQRSSQYWHFYGFDPKMYDSVEFKDIAANFSVHQDAKAMDLQ
FT                   KAFTEMVENRWDDEDFFDEKIPKRVLAIFRKGDKVREVALAPHKPNQVNKRGLPVGHAD
FT                   HRGEWRQTQPSFEKEVSYENKSTFEGARSLDHIHQNQVILVEDNQQLNGLIVGNILLAP
FT                   YHFTRGMRNREEKETRMLTQFGTYNLGKLTNKHVTKFTMMDLVALTLPPTFQARRKLKC
FT                   FRPPREGERAMLVTMQYEKAGWVAKQSAETTITPFGDRHDGLWKHRISTGPGDCGSAIV
FT                   AVADLKVVGFHNLGGKGENYFTPITIEVMDFLAEKSVTPLVPWKFSDEQVDLCGLIAAN
FT                   GADKYPFTKTISDLVSWQSLQMTKYCGENFKAIAYAPNRMSKRHVITGKRPEFIKFLDS
FT                   HPKWNAMVTPFLNGFQPSVLTHEAYYKDVLKYNKDIIVGGTDEVCFAKAVVATIGILEI
FT                   AGFSKGQFQPIYDGCKIFNDLNLDAAMGALYSGKKSAYFDGATSDEINEFFELSAAKLL
FT                   SNGHGVWSGLLKAELRPKAKVVANKTRTFTSAPIDILMGAKAVVDEFNKFFYTKHLRGP
FT                   WTVGINKFNGGWDLLAKNLMVHEWFIDADGSQFDSSITPLLMNAILNIRQYFMAEDDEA
FT                   EQMLANLYTQIINTCILIEDGTIVQKFRGNNSGQPSTVVDNTMCLIIAMEYCRMRVEKD
FT                   HEHRMRILYVCNGDDLLINADTKDKDFIQQYFADYMRELELNYSFDEAYRSIEEVEYMS
FT                   HTFMKRNSMYIPKLKRERIVAILEWQRSKEPKAIQSAIIAAYVEAFGYDEFTEMIEELA
FT                   QEVSAVWPDFKLPSRQEVEDLYLTGTRTDLGEEIKECGEQYCVYESSEAATDAVLAAAN
FT                   AGTGSASSSGSTQSSQSASTASGSGSSPSGSGSGAAGGSGSGSAQTQSNNVSVMAGLDT
FT                   GGAKTGQGSGSKGTGGSFTSNPVRTGGRATDVQDQTPGLVFPAPKITTKAIYMPKTVRD
FT                   KIKPEMINNMIKYQPRAELIDNRYATTEQLNTWIREASEGLDVTEDVFINTLLPGWVYH
FT                   CIINTTSPENRALGTWRVVNNAGKDNEQQLEFKIEPMYKAAKPSLRAIMRHFGEGARVM
FT                   IEESVRIGKPIIPRGFDKAGVLSINNIVAACDFIMRGADDTPNFVQVQNSVAVNRLRGI
FT                   QNKLFAQARLSAGTNEDNSRHDADDVRENTHSFNGVNALA"
XX
SQ   Sequence 9384 BP; 2977 A; 1905 C; 2287 G; 2215 T; 0 other;

  AF454455  Length: 9384  May 8, 2002 15:56  Type: N  Check: 4264  ..
       1  aaattaaacc aacccaaatc gatctgacaa cgaacaaaac gaactcaaag
      51  cactcacaag ctcaagttca acaaagttca tcacgcagaa agcaattcgt
     101  tcattgtgag ctctcgcata gagataagca atggcaacag cgaattgttt
     151  gctcggtgac ttcggaaggc agggggtcgt cgctaacgac ccatacgtac
     201  agtgcagagc gcgcacgctg attttcctaa gcactgagga ggaggttgat
     251  gtggtggtta accaccacgg accaggaagc attttctggt caaaagaagg
     301  tatcttaaca cagacggcta agaaccttta caaagctact gcgtatggcc
     351  taggctacga ccttgcagca aacgtcttcg tttgcggcaa gtgtaggtcc
     401  agctgcactc agtataagta cttcatcgag gatcactttg cctgcgacaa
     451  actcgtggag aagaactgcg cgtacatcaa ggatgataag tacgtgaagg
     501  ttgtggaggc attcccaatt atgccatctt atgccacacc agggcaagaa
     551  acacgcatca tacagtggat gaataagaca agtcaatgcc ttgctgatca
     601  ctgcatccaa cgcactcgcg aaatcacttt caccaactca aaaactcagg
     651  aggaagaaac tcgcgtgaag gattgcagtt tggaagtatt ttatgatgac
     701  ttcgatgaag ctcatgcagt gattgagcac gcacatcgga agaatccggt
     751  tcacgaatat aaggagaagc agctacggat gacttcaaat aacatagctg
     801  cgttagtgga ccaagtgaca cggatgatgc actccaaggg caaaacagtg
     851  gaaatagttg ggagtaaagg ccataagaaa tttgccaaaa ttccactgaa
     901  gcacacaatg ggatatccaa agcgggattg ggacgcaaca aaggacatac
     951  cagaagattt cagaggcttt atcacaactt atagtggcgt catacaatac
    1001  acgcgcaaag tgcaggatca cgaagtgacg cttggatgga gtggtgttct
    1051  tctcagtgag atggatgttc ctgatggcta tcaagaagat tgcgttgacg
    1101  gtctatttat tgtcatggga agatgcgcac atggacgcat ccaaaatgca
    1151  ctgaaaccaa aatgcacaca tggatttaga tggtatggcg accaagcagt
    1201  gaacaaagtc attccgaaat atcacgatgt gtgcaacaac aactgcgcaa
    1251  gttacctgga agccttgcca agaaaggtta gccgcgtatg gcaatcaatg
    1301  tttgacatac ataatctgag gtgcgaccaa tgtagaacag agtggaagat
    1351  gcggacagcc tcagagcatt tgcaattgtt acagaaatct gtggaacatt
    1401  acatgcaaac gtatccagac agcgatgtaa cactgttcaa agcattcttg
    1451  caagcactag ggccagatga agaggttgag gcacgccagc tcaaacccaa
    1501  caatacattg caacttgtag atgtgtggcg aacaatgaaa aacacaataa
    1551  acatcccgaa tagaatcatc tacatgggca tgttcacgga caattatgga
    1601  aattttgatt tctttccgaa cacatcaatg cctgaattat tcgccatgca
    1651  catgcaaccg gtgcaacata agatgctaga agatggaaca attgaaacga
    1701  attttaggtt cgttgatttg gaagggaaaa tccaaactag cattgaaagt
    1751  ttgtatccaa catttgacag cacatactgg aatgaacagg cacgcagagt
    1801  tcacagaatc caaccgctag cagactgctc gatggaaatt aacggcgagt
    1851  ctaagcccat ttgtcactgg gaaggaaatg tgcctttgta caatcccatt
    1901  attcgtgcaa cgcctggaca attgccgttt ggagttacaa cgcacttgct
    1951  gagtgtaaat gacaggagtg gaagattcca ttatgtgccg aagaatgggt
    2001  attgttacat gtacatattt gcctgtgcga tgattttctg tagtaatagc
    2051  aatcgttcca cagttgatgc cttcgttcgg caggtctgcg aggatctggg
    2101  tccttggcca acatttggtg atgtgctaag acaacttgcc tggatggcga
    2151  ccttttacgg atgttatgat gcattggtgc cagtaatctt ggtagaccac
    2201  acaagaaaga ccatgcacgt gccaacaccg tacggtataa agcaatcagg
    2251  aatgcatacc atcagagtca acacagtgct agagttgata actctcgata
    2301  ccatggccag tggagcaatg aaagaataca aaataggcgg gtttcaagag
    2351  acagttctta gcatacaagc atgcgtcaag agcagaaaag aatttgtgcg
    2401  caaaatcaac aaggatgcag aatggttggt ggacatgttt attaatcctt
    2451  caacgctctt cgtgttagga ggcttaattg aagtgcacca agtcattctt
    2501  gctgatgtcg aaaattcatt cgacaaatca gcagctttac taaacttgcg
    2551  ccaaatagct ttaaagctcg gaccacatct ggaatcaaag cagcgcgtac
    2601  gtcagtacat ggagttaatg attcagcatc gagcatcagt tgaagcaata
    2651  atcccatcgc aacacatgaa agctgagatg atgcaataca ttgatgcact
    2701  gcaacgctca attcttgagg agcaagtaat catagagatg gatcgagttg
    2751  gaggaaagga aaaaatgctc gtcgagcaag atctttcaca cgcagagtgt
    2801  gcgtacaacg agttcttcaa ctccattggc tatttaaact ttcatggaac
    2851  cgttttacga ctcacatatt ctggtccagg aagaaaggtt ggagaagtgc
    2901  tagagagttt aagagacaac tggttgacac gctatctccg aggaccgaag
    2951  cagccgagag actacaaagg gagttccttg aggatttgga ggaaggttac
    3001  tcacctttgc ggaaacgctt acaggtgggt attttacaac atggccgcga
    3051  acgtcttgca agttatactc ataggccttt ctaccgtttt cggagcatat
    3101  ttattaaaga agatcttaaa aatgctgcag tgggagaagg agcaagaaag
    3151  caccgaattg gttgaatacc aagggaagcg agaggaagca tggataacac
    3201  gagtgatggc tgtattgtat ataatagctt cacttttctc cgtagatttt
    3251  agttctgctt tatattcgaa tttggtgaag ttcagaacca tatttgacat
    3301  tttgaagttt aattgcgagt atcagagtgg aatttttgaa agtttgaaaa
    3351  atcaactcgg caacatccct gcgtttcatg aggtacattt gtatgaccat
    3401  gaggcaacac aagtagcagt cccaccagct atattgacat tcgagcgatg
    3451  gttcgaaact cggatcacat ctggccagca aggatatgca ccacttgatg
    3501  gtagccacgt gagcttaacg atgacaaaag acacagttgg tgaaatttca
    3551  acacaagtac aaacgcacaa ggcaaaggag tttctcatta taggacatgt
    3601  tggatgtgga aaatctacag cttttccagc aacactttcc cggaatgggc
    3651  gtgtgatgat atgcgaacca acccgcgtgc tagttacaaa tttgcaggat
    3701  tcaatgctag caacgagaaa tctaagtatc agtgccatga tgcgaaacca
    3751  ccgggttatg acagcgtcga atataacagt aactacgtat gggtatgcac
    3801  ttcactactt gtacaacaac tcacataacc tttcagagta tgattatatt
    3851  ctttttgacg aagtgcacca aacctcggca gagatgctag tgttttacaa
    3901  ctggcttaag agcacaacgt gggagggcaa gctcatcaag ttaacagcca
    3951  cgaacaacac agttaatggc gacatgcaaa cacagcaagc ccttgatgtc
    4001  aaaacgtggc cggttatgga tcacagaaca tttatgcagg agcaaggtcg
    4051  aggaacggct cacgatgcat caactcttgg tgatgtcatc atagtcttct
    4101  taacttcgtt tcgtgaaatt gatgaatctg ctgatatttt aagcaaaaat
    4151  tcaaagattg gcgtaataaa ggcagatagt cggcacttgc gaaacaaagt
    4201  tagcttgatg gatgatgttg aagcactccg agctgagaag aaatacattc
    4251  ttgcaactaa tattcttcaa aacggtgtga atttgcatgc agacgttgtc
    4301  gttgattttg gcttcaagat tgtaccagcc attgacagcg acaatcggat
    4351  gatcacagtc aagcgccaat tgatcaacaa atcagacagg attcagagac
    4401  taggacgagt gggccggatg aagatgggat acgcaaggaa aatcggaaat
    4451  gaaatagatg cttcattcgc tttggatgaa gtcacagcta cggaagctgc
    4501  cttgttggca tttggactcg gtgttgctcc agtgttgcag aatgttgatc
    4551  aacacacatt cggaaaaata acagcagagc aagttcgaac agctgcacgc
    4601  tttgaaatgc aattgtcgta tatggtgtgg atggtcaaca gagatggcac
    4651  tatggccaca cggttatatg aacaattcaa gtcattgctt ttaacaccag
    4701  gaaacacgag tttggctccg tactatgaaa cactcgttga cactcacaga
    4751  ttcagaacca ttggacaata cgcaactctt ggatacatgc gcacagacga
    4801  aaagcaccat ttggtattac cgtttcacca taatgacgtg agtgttgaat
    4851  ttgccgaaag gattggcgaa gcctatatgg cctctcaagt cccaacatca
    4901  atcaagttgc gcgtacctgc tgtaaatcat agagaagtgg cgatgaagat
    4951  gtcagcaaat cctgaagatg tgggaaccat attgtatatg gttgagcaag
    5001  cgctaataag tgaaaagacg aaactggaga atctaaccca ggcattccag
    5051  cagcaacaat caacatattg cagcgtgctc atccctaatt ttaatgttgc
    5101  tggtcggcta acacaggcaa tggatcgcat aagaaagaat gtttctgtgc
    5151  tgcaacacca gaaaacagct ctcgaaaagg cagcagtgac ttacgactac
    5201  acgaagttag ttgagctcct tgacgaaaat ccaagcatag cttcccatgt
    5251  ttcatatcag gctgggccag caaaattcat tgatgaattc atattggaga
    5301  agcgcgatta tgggtggcta ccatatcttg cagtaggaac tgcgtgtgca
    5351  attgctggca caacacttgt aatgatgtac taccgtcgca tgaagcgtag
    5401  tgtcaagttt gagggcaaag cagcacgcaa caggagtgca aaacgacaat
    5451  cagccagaga ccaaaagatg gagcgtggca acgaatacac gtactacgat
    5501  gctggtgaca ccctgtataa tggagttcaa gagaatatga atcatgcacc
    5551  agactggacc gatcggatta agaagaagac tcatgcatac gctatgcaat
    5601  ttggtaggga agtaccaaag actgaaacac agcgatcttc gcaatactgg
    5651  cacttctacg gttttgatcc aaagatgtat gactcagtcg aattcaagga
    5701  catagcagca aacttttcag tgcaccagga tgcaaaggca atggatttgc
    5751  agaaagcttt cacagaaatg gtggaaaatc gttgggatga tgaagacttc
    5801  ttcgacgaga agataccaaa gcgagttttg gccatcttca ggaaaggaga
    5851  caaggttcgt gaggttgcat tggcacctca caagccaaac caagtcaaca
    5901  agcgcgggct acctgtcgga catgctgatc acagaggaga gtggagacaa
    5951  acacagcctt catttgaaaa agaagtgtcg tacgagaaca aatcaacttt
    6001  cgaaggtgca cgttcacttg atcatatcca tcagaatcaa gtcatcctcg
    6051  ttgaagacaa tcagcaatta aatgggctaa tagttgggaa catactcttg
    6101  gcgccatatc atttcacacg aggtatgagg aacagagagg aaaaggagac
    6151  acgcatgctg acacagtttg gaacgtacaa tcttggaaaa cttaccaaca
    6201  agcatgtcac aaaatttaca atgatggatc tggtagcatt aaccttgcct
    6251  ccaacatttc aagcaagacg gaaactcaag tgtttcagac caccaaggga
    6301  aggagagcga gcaatgttgg tgaccatgca gtacgagaaa gcaggatggg
    6351  ttgccaagca atcagcggaa acaacaatca caccattcgg tgatcgacat
    6401  gatggtttgt ggaagcatag aatttcaaca ggaccaggtg actgtggaag
    6451  cgccatagta gcagtagcag acctaaaagt tgttggattc cataaccttg
    6501  gagggaaagg tgagaattac ttcacaccga taactattga ggtcatggat
    6551  ttcttagctg aaaagtctgt gacaccgctt gtgccatgga agttctcaga
    6601  cgagcaagtt gacttatgtg gtttaattgc ggccaacgga gcagacaaat
    6651  acccattcac caaaacaata agcgacttgg ttagttggca aagtctccaa
    6701  atgacgaaat actgtgggga gaacttcaag gccatcgctt atgctccaaa
    6751  ccgaatgtcg aaaaggcatg tcataacagg aaagaggcct gaattcatta
    6801  aatttctaga ttcccacccg aagtggaatg caatggtaac acctttctta
    6851  aacggatttc aaccatcagt tctgacacat gaagcatatt acaaggatgt
    6901  gttgaagtat aacaaagaca taattgttgg agggactgat gaagtgtgtt
    6951  ttgcgaaggc agtggtcgca actattggga ttctagaaat agccggattt
    7001  tcaaagggac aatttcaacc aatctatgat ggatgcaaaa ttttcaacga
    7051  cttgaatttg gatgccgcaa tgggagcttt gtactcaggg aagaaatcag
    7101  catactttga cggagcaaca agcgacgaaa tcaatgaatt ctttgaactg
    7151  agtgcagcga agctactcag taatggacat ggagtatggt ctggtttact
    7201  caaagctgag ttgagaccga aggcaaaggt cgtggcgaac aaaacgcgaa
    7251  cattcacatc agcaccaatt gatatactca tgggtgccaa agctgtggtt
    7301  gatgagttca acaaattctt ctacacaaag catttgcgcg gaccatggac
    7351  tgtcggaatc aataagttca acggaggttg ggatttgttg gccaaaaatc
    7401  taatggtgca cgagtggttc attgacgctg atggttctca attcgacagt
    7451  tcaatcactc cacttcttat gaatgcaatt cttaacatac ggcaatactt
    7501  catggcagaa gatgatgaag ctgaacaaat gctggcaaac ttgtatacgc
    7551  agattataaa cacatgcatt ttaattgaag atggaacgat tgtgcagaag
    7601  tttcgaggta ataacagtgg ccaaccaagc acagttgttg ataacacgat
    7651  gtgtttaatc atagcaatgg agtattgcag aatgcgcgtt gaaaaggacc
    7701  atgaacacag aatgaggata ctgtacgtgt gcaacggaga tgatttgctt
    7751  atcaatgccg acacaaagga caaagacttc atacagcagt attttgccga
    7801  ttacatgcgc gaactggagc tgaattactc atttgacgag gcttaccgta
    7851  gtatcgagga ggtggaatac atgtcacata catttatgaa gcgaaattcg
    7901  atgtacattc caaagttgaa acgcgaacgt attgtggcaa ttctggagtg
    7951  gcagaggagc aaggaaccga aggctattca gagcgctatt attgcagcat
    8001  acgtggaagc tttcggttat gatgaattca cggagatgat tgaagaactt
    8051  gcgcaggaag tttcagcggt gtggccggat ttcaagttgc cctcacgaca
    8101  agaggttgag gatttgtact tgactgggac ccggacggat ttaggagaag
    8151  agattaagga atgtggagag caatactgcg tgtacgagtc gagtgaggcc
    8201  gcaaccgacg ctgtcttggc ggcagcaaat gcaggaactg gtagtgcatc
    8251  gagtagtgga agcactcaat caagtcagag cgcgagtact gctagcggat
    8301  cagggagttc accatcagga tcaggttctg gagcagcggg tggatcaggt
    8351  tctggatcag cacaaacaca atctaataac gtatctgtca tggctggcct
    8401  cgacacggga ggagctaaga caggtcaagg atcaggatca aaagggacgg
    8451  gtggttcatt cacatcgaat cccgtgcgaa ctggaggccg agcaacggat
    8501  gtgcaagatc agacaccagg tttagtgttt ccagcaccaa agatcacaac
    8551  aaaggccata tacatgccaa aaactgtacg cgacaagata aaacctgaaa
    8601  tgataaataa catgatcaaa taccaaccgc gtgcggaact tatcgacaac
    8651  agatatgcca caactgaaca actcaacacc tggataagag aggcatctga
    8701  agggcttgac gtgacagagg atgttttcat aaacacctta cttccaggat
    8751  gggtctacca ctgcataatc aacacaacga gcccagagaa cagagcacta
    8801  ggaacttggc gcgttgtgaa caatgcaggc aaggacaatg agcagcaact
    8851  cgagtttaaa attgaaccga tgtacaaagc tgcgaagcca tcacttcgag
    8901  caattatgcg ccactttggc gaaggagctc gagtgatgat tgaggagagt
    8951  gttcgaattg gaaaacctat cataccaagg ggcttcgaca aggccggtgt
    9001  gctaagcatc aacaatattg tggcagcgtg tgatttcatc atgcgcggtg
    9051  cagatgacac accaaatttt gtgcaagtgc aaaacagcgt tgcagtaaac
    9101  aggctacgcg gaatacagaa caagctgttt gcacaggcac gactgagtgc
    9151  gggtactaat gaggacaact cacgtcatga tgcagatgat gtgagggaga
    9201  acacgcacag tttcaatggt gtaaacgctc ttgcgtgagc acagtagaaa
    9251  ctacaaatcc acgagtacca ggatttgagc gaaataacgc tgcgtttcgt
    9301  taacccttcg ttgttactag gtgtgtactt ctccacgaga ggcgtgcatt
    9351  cttggtagct atgtgtgggt tagggcgacg ctac