!!NA_SEQUENCE 1.0
ID   TRA7293    standard; RNA; VRL; 3864 BP.
XX
AC   AJ007293;
XX
SV   AJ007293.1
XX
DT   24-SEP-1999 (Rel. 61, Created)
DT   24-SEP-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Tobacco rattle virus genes encoding coat protein and 27 and 33 kDa proteins
XX
KW   27 kDa protein; 33 kDa protein; coat protein; cp gene.
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-3864
RA   Koenig R.;
RT   ;
RL   Submitted (18-JUN-1998) to the EMBL/GenBank/DDBJ databases.
RL   Koenig R., Institut fuer Biochemie und Pflanzenvirologie, Biologische
RL   Bundesanstalt fuer Land- und Forstwirtschaft, Braunschweig, Messeweg 11,
RL   D38104, GERMANY.
XX
RN   [2]
RA   Schmidt K., Koenig R.;
RT   "Genetic analyses of large-sized RNA 2 species of a TCM-like tobacco rattle
RT   virus source from spinach";
RL   Arch. Virol. 144:503-511(1999).
XX
DR   SPTREMBL; Q9QBL0; Q9QBL0.
DR   SPTREMBL; Q9QBL1; Q9QBL1.
DR   SPTREMBL; Q9QBL2; Q9QBL2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3864
FT                   /db_xref="taxon:12295"
FT                   /virion
FT                   /organism="Tobacco rattle virus"
FT                   /isolate="SP"
FT                   /specific_host="spinach"
FT   CDS             710. .1342
FT                   /db_xref="SPTREMBL:Q9QBL2"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAB56545.1"
FT                   /translation="MAGTYGDSFEGKILDDLSGAWVEKHNWSDILKRLTKIKFALQADR
FT                   DMIPGIVEDLNTEIPVDEFTRFPAGKVYHLLSKELLLAIEAIHAASSFKRRAEEKNNVN
FT                   PRQRFDAEGSTTQLNPGGTVVRPVTGNNDSSLGEDMFSNSKLDDASTAFHKSLATLKGS
FT                   RPKAVVQRTFEREYNLKWVAGTAGAPAGGNAVASGGTPPGGGRGPGP"
FT   CDS             1473. .2189
FT                   /db_xref="SPTREMBL:Q9QBL1"
FT                   /note="ORF1"
FT                   /product="27 kDa protein"
FT                   /function="unknown"
FT                   /protein_id="CAB56546.1"
FT                   /translation="MVNGDWADKWPAENLFIDDFGKLVWFDILDDVVGITHFVSQVPTD
FT                   LSNIPKAFISFIDNRVPMCINSKGWIFMRVKVDGRDVYYQKLGELDVSSFGDSILSPDF
FT                   EFKFTKITVPVDKQLVSRINSLEKLNAQLTTDLSQARTLKNFEELREGLVLNYSKAGGR
FT                   LYRMVVRMIGGNWKLVAEINNDSDRWATLSANLVLKPDAQYLGYKVVRRFNAIGLEFDL
FT                   ARLNAIDIPTLLTSVV"
FT   CDS             2364. .3227
FT                   /db_xref="SPTREMBL:Q9QBL0"
FT                   /note="ORF2"
FT                   /product="33 kDa protein"
FT                   /function="unknown"
FT                   /protein_id="CAB56547.1"
FT                   /translation="MGDVFSAFILELTSEVTFSVWFNRKNFSTNSGRVFPFDGTIPTIG
FT                   DWLVVYCHWWPDGSTTIHLSTRSHNVDVGRSCTFSVAGRNRRKFQVERDLPMYNTVSHR
FT                   NANFENGFRIRFPESSPFTVDFVLSFRPNLCKFSNASGSIIVIGPRFDVVVGLENYLDL
FT                   LKGRLRIPRAIPIPVIALVVSIIGILVSISGIVVNALTRFTPIENVVLVWVDSIHRFVV
FT                   YKHERFDIRSVRTVSVEQVKALLAGPTNAEKFSREYGWKVYSPFFTALVWDEMAKDSVF
FT                   GSTYST"
XX
SQ   Sequence 3864 BP; 1088 A; 637 C; 906 G; 1233 T; 0 other;

AJ007293  Length: 3864  December 21, 2001 15:35  Type: N  Check: 3334  ..
       1  ataaaacatt gcacctttgg tcgtgccctg gctggggtat gtctttgaac
      51  gcagtagaat gtgctaattg acaagttgga gaacgcggta gaacgtactt
     101  atccgacaca gcctttatcc ctcttcctga cgaggttttt gtcagtgtat
     151  catgttgttt tgaactatcc aacttagtac cgaatgggga aagtgattgg
     201  tgtgcttatc ttcgatatga tactttgaaa tttgtgtagt aggtagttag
     251  aaaagaaact cttgtcttct caaacaagta aaacctgaga cgtgttaact
     301  acgaaagtgt ccattttaaa atctgtggtt gaatgttgtg ttcaactgtg
     351  gaaaccaaaa ccgatgtggg aagaactgga ctgatacttc agtctgaggt
     401  gtttctacga tcgcaagggt gtgttaaagc cctgggggtt ttctggtttc
     451  tttagagaaa atcagataag atcttaatat cattattgag gttggcataa
     501  ttatactgat tatgtcctcg ttgatagaga ctatcatctg tcatttgctt
     551  caagaaacaa tggcattggt tcggaacgac ctcatttctt agttatgtaa
     601  ctaggaattg cataaattta acaaaggttg ctaagcaact tattttgaac
     651  actttgataa gaagatttgc tgaaacactg gttgcttaat cacttactct
     701  tcttcaccaa tggctgggac gtatggagat tcctttgaag ggaagatctt
     751  agatgatctg tctggagctt gggtcgagaa acataattgg agcgatattc
     801  ttaaaaggtt gacaaagata aaattcgcct tacaagctga tagggatatg
     851  attcctggaa ttgtagaaga tttgaacact gaaattccag tggatgaatt
     901  tactagattt ccggctggca aggtttatca cttactgtcc aaagaattgc
     951  tgttggcgat tgaagctatt cacgctgcat cttccttcaa aagaagagca
    1001  gaagagaaga acaatgtcaa tcccaggcaa cgatttgatg ccgaaggatc
    1051  tacaacgcag ttaaacccag gaggaactgt ggttagaccc gtcactggta
    1101  acaacgattc atctctgggc gaagatatgt tttctaatag taagttggac
    1151  gacgccagca ctgctttcca taagagttta gccactttaa agggcagtcg
    1201  gcctaaggcg gttgtccaaa gaacgtttga aagagaatac aatctgaagt
    1251  gggtggcagg aacggctgga gcaccagcgg gtggcaatgc agtagcaagt
    1301  ggcggcactc cacctggtgg tggacgtggt ccgggtcctt gatcttctca
    1351  actttgtcag tatttcatgg tctggttgac catttggttt tggttttgag
    1401  cagcgttggg ttacgaatat gatcgcagtt ttaaatgtct tttgactttt
    1451  gtcgcagacg gcatatgtga aaatggttaa cggagattgg gctgataagt
    1501  ggccagctga aaatttgttc attgatgatt tcggaaaatt agtatggttt
    1551  gatattctag atgatgtggt tggtatcact cattttgttt ctcaagtgcc
    1601  aacagatctt tcgaatatac ctaaagcatt catctctttt attgataatc
    1651  gagtccctat gtgcataaat tccaaaggtt ggatattcat gagggttaag
    1701  gttgatggga gagacgttta ctatcagaaa ttgggagaac tagacgtttc
    1751  ttctttcgga gactcaatat tatcacctga cttcgagttc aaatttacga
    1801  agattacagt gcctgttgat aaacaattgg ttagcagaat taactcttta
    1851  gagaagttaa atgctcaact aacgacagat ctcagtcaag ctcgtactct
    1901  taaaaatttt gaagaacttc gagaaggttt agtgttgaat tattcaaaag
    1951  cagggggtcg gctctacaga atggtggtaa gaatgatagg tggaaactgg
    2001  aagttggttg ccgaaatcaa caatgattca gatagatggg ccactttgag
    2051  cgctaacttg gtccttaaac cggacgcaca atacttaggc tacaaagttg
    2101  taagaagatt taatgcgatc ggacttgaat tcgatttagc aaggttgaat
    2151  gcgatagaca ttccaacttt gttaacgtct gttgtgtaaa ccaaattact
    2201  tatgtgggtc gatcacatcg acggtggcct agaccatact aggtgaagtt
    2251  gtgggaagct tcgaaaataa ttcccgtggg caaatctcat ttgcggtggt
    2301  tgttaccata aacaataatg tcgttggttg catttaaaat aattcctttt
    2351  gtctgttggt aacatgggag atgtattcag tgcttttatt cttgaactaa
    2401  cttcggaagt tactttctcc gtgtggttta ataggaagaa cttttccact
    2451  aattctggtc gtgtatttcc tttcgatggt actattccaa caatcggtga
    2501  ttggttagtc gtttattgtc attggtggcc tgatggttca acaacaatac
    2551  atttatcaac aaggtctcac aatgtcgacg ttggaaggtc ttgtacgttt
    2601  tcagtagctg gacgtaatag acgtaaattt caggtggaaa gagatttacc
    2651  aatgtacaac actgtttctc acaggaacgc gaattttgaa aatggtttca
    2701  ggatcagatt ccctgagtcg tctcctttca cagtcgattt tgttttgtcc
    2751  tttagaccta acttgtgtaa gttttctaat gctagtggtt ctatcattgt
    2801  aattggacct aggtttgacg tggtagttgg tttggagaat tatcttgact
    2851  tacttaaagg tcggttgaga attcctcgcg ctatacctat tcccgtaatt
    2901  gcgttagttg tatctataat aggtatactt gtatcaatat ctgggattgt
    2951  cgtgaatgca ttaacacgct ttacgccgat agagaacgta gtattggtgt
    3001  gggtagattc gattcataga tttgttgttt acaaacacga aagatttgac
    3051  atccgatcag ttagaacagt atcagttgag caagtaaaag cactactagc
    3101  tggtcccacg aatgctgaga agttctctcg tgagtacggt tggaaggtgt
    3151  attccccttt tttcactgca cttgtctggg atgaaatggc gaaagacagt
    3201  gtctttgggt cgacgtattc aacctaagca agatgtttgc tgaaggacgt
    3251  taaaatcaat aacctactga gtaatttctt acctagaaaa ctgtttgcgc
    3301  agttagtaaa gatagaaagg aaagttgatt ggagttgatt ttgttgagaa
    3351  aatttgtatt tttacttttg atgtgtataa ttgttgtgac cgtagtcacc
    3401  ttgaaaaatg tcgtaaacgc gttgaagcac gaaatcggga gacctggaaa
    3451  caggtcaagc gaactcaagc tgaaaaggcg tttgctacag tcaaaaagtc
    3501  tcgttcgagg ccttctaaga agaaattaat aggaggaaga gagtttgggg
    3551  caccaaaagg attttaaaat gatgttcctt taggaattat tcagttgttt
    3601  gcttttgatt ttattttaaa ttgttatctg tttctgtgta tagactgttt
    3651  gagattggcg tttggccgac tcattgtctt accatagggg aacggacttt
    3701  gtttgtgttg ttattttatt tgtattttat taaaattctc aatgatctaa
    3751  aaaggcctca cggccaagag attattgggg ggtgggtaag tacttttaaa
    3801  gtgatgatgg ttacaaaggc aaaaggggta aaacccctcg cctacgtaag
    3851  cgttattacg ccca