!!NA_SEQUENCE 1.0
ID   TRV9833    standard; RNA; VRL; 3216 BP.
XX
AC   AJ009833;
XX
SV   AJ009833.1
XX
DT   31-OCT-1998 (Rel. 57, Created)
DT   25-MAR-1999 (Rel. 59, Last updated, Version 2)
XX
DE   Tobacco rattle virus (TRV), complete RNA2 sequence of isolate TpO1
XX
KW   2B gene; 2b, 29K protein; 2C gene; 2c, 18K protein; 9K protein;
KW   coat protein gene; k gene; viral coat protein.
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-3216
RA   MacFarlane S.A.;
RT   ;
RL   Submitted (30-JUL-1998) to the EMBL/GenBank/DDBJ databases.
RL   MacFarlane S.A., Virology, Scottish Crop Research Institute, Invergowrie,
RL   Dundee, DD2 5DA, SCOTLAND.
XX
RN   [2]
RA   MacFarlane S.A., Vassilakos N., Brown D.J.F.;
RT   "Similarities in the genome organization of tobacco rattle virus and pea
RT   early-browning virus isolates that are transmitted by the same vector
RT   nematode";
RL   J. Gen. Virol. 80:273-276(1999).
XX
DR   SPTREMBL; Q9YMC9; Q9YMC9.
DR   SPTREMBL; Q9YMD0; Q9YMD0.
DR   SPTREMBL; Q9YMD1; Q9YMD1.
DR   SPTREMBL; Q9YMD2; Q9YMD2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3216
FT                   /db_xref="taxon:12295"
FT                   /virion
FT                   /organism="Tobacco rattle virus"
FT                   /isolate="TpO1"
FT   CDS             475. .1065
FT                   /db_xref="SPTREMBL:Q9YMD2"
FT                   /gene="coat protein gene"
FT                   /product="viral coat protein"
FT                   /protein_id="CAA08870.1"
FT                   /translation="MGSYGDSFEGKILDDLSQPWCEKHNWADVLRRLSKIKFALQNDRD
FT                   MIPGILEDLTTELPVDEVTRFPLMKIYYSLSKEVMIAIETIHSASSFKRRAEEKNNVNP
FT                   RQRFEADTATTLVTPGGGAIRPAGSGDSALTEDAFSHGKLDDASTAFHKSLAMLKGERL
FT                   KAYTQRGFEKEYGLKWAGSAPATSSGGGKGPVV"
FT   CDS             1111. .1356
FT                   /db_xref="SPTREMBL:Q9YMD1"
FT                   /gene="k gene"
FT                   /product="9K protein"
FT                   /protein_id="CAA08871.1"
FT                   /translation="MLGTNDGENVQCVQLGGESARGQYTSNHVDLFEVRVLFPEVRLYW
FT                   ARDRTEKLQFQHSRPIEPFEWCLVGGCICVANVLVF"
FT   CDS             1388. .2161
FT                   /db_xref="SPTREMBL:Q9YMD0"
FT                   /gene="2b gene"
FT                   /product="2b, 29K protein"
FT                   /protein_id="CAA08872.1"
FT                   /translation="MTTDRVTLWPNDQLFLSDTYQLVWFDETRDKVEHKHFSYQASNDL
FT                   LSIPKSFLSFVDNRLPMCINHKGAVYIKVGTGGDAYYQKFGDLEVSKFNDDFLPQDAHF
FT                   VFNNVVIGDNDDVSKTEELASLKKKNEVLQSEVVTSREHSDAIISKLKLDLVQSKMNYS
FT                   VKVEPGLVLGYGKAGGELTRTIVSIVKTNLVVLGERYVRDSHAWKQMGVLHNIKSGSRY
FT                   VAYTFVEESGVMYITYSIGKLRDMSVEELLSSVAF"
FT   CDS             2337. .2804
FT                   /db_xref="SPTREMBL:Q9YMC9"
FT                   /gene="2c gene"
FT                   /product="2c, 18K protein"
FT                   /protein_id="CAA08873.1"
FT                   /translation="MISWTLGWFRLYLPQGGDGERTLRISWRGTNVYMFGEQVELPTCW
FT                   DNNSWRGSAYRVIRMNHIDYHVRVFYTWLGAMHHCYVWIYYPAGGGISHYRRRLVVDNR
FT                   NNNYAAGEEFPFNNVNLLTGVVTQGDLLHGVSLNAGTHLYTFTPTLELRWG"
XX
SQ   Sequence 3216 BP; 891 A; 565 C; 794 G; 966 T; 0 other;

AJ009833  Length: 3216  December 21, 2001 15:35  Type: N  Check: 5041  ..
       1  ataaaacatt gcaccattgg tgttgccctg gctggggtat gtctttgaac
      51  acagtagagt gtgctaattg acaagttgga gaacgcggta gaacgtactt
     101  atccgacaca gcttttatcc ctcttcacga cgaggttttt gtcgatgtat
     151  ttttagttta gctagatcag taaataaact cttgtcttct catacaagga
     201  aaacctgaga cgtgttaact acgaaagtgt ctattttaaa actgtggaaa
     251  cgctaatcgg cggttctgtg gaatccaaaa acgccaaagt cttcatgatt
     301  ttgtgtgcaa gagtgtgtat aaagctctgg tttgaaaatt gaacttgtcc
     351  ttcttacgga tcaaaaccat gtcaagaatt gtcgtatatg agttgaacaa
     401  gtgttcaact acagcatatt aataatcttt acactgtcta cagtgcaacc
     451  tcaggtagct gcattcattg tcagatgggt tcgtacggtg attcttttga
     501  agggaaaatc ttggatgatt tgtctcaacc atggtgtgag aagcacaatt
     551  gggccgatgt cttgagaaga ctgtcgaaga tcaagtttgc tttgcaaaat
     601  gatcgcgaca tgattccagg gattttggaa gatctgacta ccgaacttcc
     651  cgttgatgaa gttacgcgat ttcctttgat gaaaatttat tactcactct
     701  cgaaagaagt catgattgct attgaaacaa ttcactctgc ttcgtcgttt
     751  aaaaggcgtg ctgaagaaaa gaacaatgtg aatccccgtc aaagattcga
     801  agctgatact gcgaccactc tcgtgactcc gggtggtggg gctattcgtc
     851  ctgctggttc cggtgattcg gctttgactg aagatgcatt ttcacatggt
     901  aaacttgatg acgcaagtac ggcttttcac aagtctctag cgatgttgaa
     951  aggtgaaaga ttgaaggcgt atacacaacg tggttttgag aaggaatatg
    1001  gactgaagtg ggcaggaagt gctccggcga cctcctctgg agggggtaag
    1051  ggaccggtcg tgtgactcat tgcgaagcca tcgaggaagg ttctcagagc
    1101  gatcggaagt atgttaggta ctaacgatgg tgagaacgtt caatgtgtac
    1151  aactcggtgg tgagagtgcg agaggacagt acacttctaa tcatgttgat
    1201  ttgtttgaag tgagagtgct tttcccggaa gtacggcttt attgggctcg
    1251  tgataggacg gagaagttac aatttcaaca ttccagaccc attgaaccat
    1301  tcgagtggtg tttagttggt ggatgcattt gtgtagccaa tgtgttagtc
    1351  ttttgaaaca taaccgtcag gttttgttca gcatataatg actacagatc
    1401  gggttacatt gtggccaaac gaccaactgt ttctttccga tacctatcag
    1451  ttagtctggt tcgatgagac acgtgacaag gtggaacaca agcatttttc
    1501  gtaccaggct tctaatgatt tgctgagcat accaaaatct tttctaagtt
    1551  ttgttgataa cagattacct atgtgtataa atcacaaggg tgctgtatac
    1601  atcaaagttg gaactggtgg cgatgcttat tatcagaagt tcggtgatct
    1651  ggaagtgagt aaattcaacg acgattttct acctcaggac gctcactttg
    1701  tgtttaacaa cgttgttatt ggagacaatg atgatgttag taaaactgaa
    1751  gagttagcct cccttaagaa gaaaaacgaa gttctacaaa gtgaagttgt
    1801  tacgagtaga gagcactccg acgcgattat cagtaaactg aaattagacc
    1851  tagtccaatc taagatgaat tattccgtca aagttgagcc gggtctggtt
    1901  ctcggttacg gtaaagctgg cggagagtta actcggacaa tcgtgtccat
    1951  tgttaaaaca aacctggtcg ttctagggga gaggtacgtt agagactctc
    2001  acgcttggaa acagatggga gtgttgcaca acattaagtc tggaagtagg
    2051  tacgtggcgt acactttcgt agaagaaagt ggggttatgt acattactta
    2101  ttcgatcgga aaactgagag acatgagtgt tgaggaactt cttagttccg
    2151  tggcatttta gtctcgttta gtactgtggg ttgatcacat caacggtggc
    2201  ttgcaccata gcaagtacag ttgtgggaag ctgtgtaaat aattcctgta
    2251  tcttgatctc atcaagggtg gttgttacca taaacaataa tgttgtagga
    2301  agcatttaaa ataattcctg gcttatcgaa atcacgatga tatcctggac
    2351  attaggatgg tttaggctgt acttaccaca aggaggtgac ggagagagga
    2401  ctttgaggat cagctggcgt ggaaccaacg tatacatgtt tggtgaacag
    2451  gttgaactac ctacgtgttg ggacaacaac tcgtggcgag gatctgcgta
    2501  tcgcgttatt aggatgaatc atatagatta tcacgtccgt gtcttctaca
    2551  cctggcttgg agcgatgcac cactgttacg tctggatata ttatccagca
    2601  ggtggtggaa tctcccatta ccgtcgccgg ttagtggttg ataaccgcaa
    2651  caataattat gcggctggtg aagaatttcc attcaataat gtgaatctgt
    2701  tgaccggtgt ggttacgcaa ggtgatttgt tacatggagt tagtctcaac
    2751  gctggcactc atctttacac atttacacct acacttgaac tgcgctgggg
    2801  ttaaggtcgt agttttaaaa ataagttgct gagatcgaaa ccttctaaga
    2851  agaaattcga agggggtaga aaaagtctcg tcactcgaaa gagtacggga
    2901  caccaaaaag attttgagag atgatgttcc atttggaatt gatcaattgt
    2951  ttactttttg attttgtatt gtattgttat tcattcctgt gtatagactg
    3001  tttaagattg gcatttggcc gacttattgt cttaccatag gggagtggac
    3051  tttgtttgtg ttgttatttt atttgtattt tattaaaatt ctcaatgatc
    3101  tgaaaaggcc tcgaggctaa gagattattg gggggtgagt aagtactttt
    3151  aaagtgatga tggttacaaa ggcaaaaggg gtaaaacccc tcgcctacgt
    3201  aagcgttatt acgccc