!!NA_SEQUENCE 1.0
ID   TRA250488  standard; RNA; VRL; 3926 BP.
XX
AC   AJ250488;
XX
SV   AJ250488.1
XX
DT   24-APR-2000 (Rel. 63, Created)
DT   13-FEB-2001 (Rel. 66, Last updated, Version 2)
XX
DE   tobacco rattle virus cp gene, 2b gene,2c gene and 1b gene, isolate PaY4
XX
KW   1B gene; 27K protein; 2B gene; 2C gene; 33K protein; coat protein; cp gene;
KW   transmission helper protein.
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-3926
RA   MacFarlane S.A.;
RT   ;
RL   Submitted (22-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   MacFarlane S.A., Virology, Scottish Crop Research Institute, Invergowrie,
RL   Dundee, DD2 5DA, UNITED KINGDOM.
XX
RN   [2]
RA   Vassilakos N., Vellios E.K., Brown E.C., Brown D.J.F., MacFarlane S.A.;
RT   "Tobravirus 2b protein acts in Trans to facilitate transmission by
RT   nematodes";
RL   Virology 279:478-487(2001).
XX
DR   SPTREMBL; Q9IW54; Q9IW54.
DR   SPTREMBL; Q9IW55; Q9IW55.
DR   SPTREMBL; Q9IW56; Q9IW56.
XX
CC   3' region is derived from RNA1 by recombination. Recombination
CC   junction is
CC   at nucleotide 3406 and replaces the RNA2 3' non-coding region with
CC   the
CC   C-terminal part of the 1b gene and the RNA1 3' non-coding region.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3926
FT                   /chromosome="recombination of RNA1 and RNA2"
FT                   /country="United Kingdom:York, England"
FT                   /db_xref="taxon:12295"
FT                   /virion
FT                   /organism="Tobacco rattle virus"
FT                   /isolate="PaY4"
FT   source          1. .3406
FT                   /chromosome="RNA2"
FT                   /db_xref="taxon:12295"
FT                   /organism="Tobacco rattle virus"
FT   source          3407. .3926
FT                   /chromosome="RNA1"
FT                   /db_xref="taxon:12295"
FT                   /organism="Tobacco rattle virus"
FT   CDS             713. .1345
FT                   /db_xref="SPTREMBL:Q9IW56"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /function="encapsidation"
FT                   /protein_id="CAB88864.1"
FT                   /translation="MAGTYGDSFEGKILDDLSGAWVEKHNWSDVLKRLTKIKFALQADR
FT                   DMIPGIVEDLNTEIPVDEFTRFPAGKVYHLLSKELLMAIEAIHAASSFKRRAEEKNNVN
FT                   PRQRFDAEGSATQLNPGGTVVRPVTGNNDSSLGEDMFSNSKLDDASTAFHKSLATLKGS
FT                   RPKAVVQRTFEREYSLKWVAGAAGTPAGVNAVAGGGTPSGGGRGPNS"
FT   CDS             1476. .2192
FT                   /db_xref="SPTREMBL:Q9IW55"
FT                   /gene="2b"
FT                   /product="27K transmission helper protein"
FT                   /function="nematode transmission"
FT                   /protein_id="CAB88865.1"
FT                   /translation="MVNGTWADKWPVENLFIDDFGKLVWFDILDDVVRITHFVSQVPTD
FT                   LSNIPKAFISFIDNRVPMCINSKGWMFIRVKVDGEDVYYQKLGELDVSSFGDSILPPDF
FT                   EFKFTKVTVPVDKQLVSKVNSLERLNAQLTTDLSQARTLKNFEELREGLVLNYSKAGGR
FT                   LFRMVVRMIGGNWKLVSEINNDSDRWATTSANLVLKPDAQYLGYKVVKRFNVIGLEFDL
FT                   ARLNAIDVPTLLASVV"
FT   CDS             2367. .3227
FT                   /db_xref="SPTREMBL:Q9IW54"
FT                   /gene="2c"
FT                   /product="33K protein"
FT                   /protein_id="CAB88866.1"
FT                   /translation="MGDVFSAFIIELTSEVTFSVGFNKKNFFTNSGRVFPFDGTIPKIG
FT                   NWLVVYCHWWPDGSTTIHLSTRSHGVDVGKSCTFSVTGRNRRKFQVERDLPMRNTVSYR
FT                   NVNFEDGFRIRFPESSPFTVDFVVSFRPNLCKFSNASGSIIVVGPRFDAAVGLESYLDL
FT                   LKGRLRISRSVIPVIALVVSIISVLVSISGIVVNALTSFTPVEDVVLVWVDSIHRFVVY
FT                   KHGRFDIQSIRTVSVEQAKALLAGPTSIEKFFREYGWKVYSPFFTALDWDQVAKDSVFG
FT                   STYST"
FT   CDS             <3406. .3671
FT                   /pseudo
FT                   /gene="1b"
XX
SQ   Sequence 3926 BP; 1092 A; 635 C; 928 G; 1271 T; 0 other;

AJ250488  Length: 3926  December 21, 2001 15:39  Type: N  Check: 6118  ..
       1  ataaaacatt gcacctttgg tgctgccctg gctggggtgt gtctttgaac
      51  gcagtagaat gtgctaattg acaagttgga gaacgcggta gaacgtactt
     101  atccgacaca gcctttatcc ctcttcctga cgaggttttt gtcagtgtat
     151  catgttgttt tgaactatcc aacttagtac cgaatgggga aagtgattgg
     201  tgtgcttatc ttcaatatga tgctttgaag tttgaatagt aggaagttag
     251  aaaagaaact cttgtcttct caaacaagta aaacctgaga cgtgttaact
     301  acgaaaatgt ccattttaaa atctgtggtt gaatgttgtg ttcaactgtg
     351  gaaaccaaaa ccgacgtggg aagaactcga ctaatacttt agtctgaggt
     401  gttcctacga tcgcaagggt gtgttaaagc cctgggggtt ttctgatttc
     451  tttagagaaa atcagataag atcttgatat tgttattatt gaggttggca
     501  taattatact gattgtgtcc tcgttgatag agactatcat ctgtcattta
     551  tctcaagaag cagtggcatt ggttcggaac gacctcattt cttagttatt
     601  taactaggaa ttgcataaat ttaacaaaga ttgctaagca acttattctg
     651  tacactttga taagaagatt tgctgaaaca ctggttgctt aatcacttac
     701  tcttcttcac taatggctgg gacatatgga gattcctttg aaggaaagat
     751  cttagatgat ctgtctgggg cttgggtcga gaagcataat tggagcgatg
     801  tccttaaaag gctgacaaag ataaagtttg ccttacaagc tgatagggat
     851  atgattcctg gaatcgtgga agatttgaac actgaaattc cagtggatga
     901  atttactaga ttcccggctg gtaaggttta tcacctgctg tccaaagaat
     951  tgttgatggc gattgaagct attcacgctg cgtcttcttt caaaagaaga
    1001  gcggaagaaa agaataatgt caatcccagg cagcgatttg atgctgaagg
    1051  atctgcaacg cagttaaacc cagggggaac tgtggttaga cccgttaccg
    1101  gtaacaacga ttcatctttg ggcgaagata tgttctctaa tagtaagttg
    1151  gacgacgcca gtactgcttt ccataagagt ttggctacgt taaaaggcag
    1201  tcggcctaaa gcggttgtcc aaagaacatt tgagagagaa tacagtctga
    1251  agtgggtggc aggagcagct gggacaccgg caggtgttaa tgcggtagcc
    1301  ggtggaggta ctccgtctgg tggcggacgc ggtccgaatt cttgattttc
    1351  tcagctttgt cggtattcta tggtctgttt gaccatttgg tttcgatttt
    1401  gaatggcgtt ggatcacgat tatgatcgca gttttaaatg tcttttgact
    1451  tttgtcgcag acggcatatg tgaaaatggt taacggaact tgggctgaca
    1501  aatggccagt tgaaaatttg ttcattgatg attttggaaa gttggtgtgg
    1551  tttgatattc tagacgatgt ggttcgcatc actcatttcg tttctcaagt
    1601  gccaacagat ctttcgaata tacctaaagc attcatctcc tttattgata
    1651  atcgagtccc tatgtgtata aattccaaag gttggatgtt tataagggtt
    1701  aaggtcgatg gagaagacgt ttactatcag aaattggggg aactagacgt
    1751  ttcttctttc ggagattcaa tattgccgcc tgacttcgag ttcaaattta
    1801  ctaaggttac agtgcctgtt gataaacagc tggttagcaa agttaactct
    1851  ttagagaggt taaatgctca actgacgaca gatctcagtc aagctcgtac
    1901  tcttaaaaat tttgaagaac ttcgagaagg tttagtgttg aattattcaa
    1951  aagcaggagg tcggctcttc agaatggtgg taagaatgat aggtggaaat
    2001  tggaagttag tttccgaaat caacaatgat tcagatagat gggccactac
    2051  gagcgctaac ttggtcctta aaccggacgc acaatactta ggttacaaag
    2101  ttgtaaagag atttaatgtg atcggacttg aattcgattt agcaaggttg
    2151  aatgcgatag acgttccaac tttgttagcg tctgttgtgt aaatcgaaac
    2201  acttatgtag gtcgatcaca tcgacggtgg cctagaccat actgggtgaa
    2251  gttgtgggaa gcttcgaaaa taattctcgt gggcaaatct catttgcggt
    2301  ggttgttacc ataaacaata atgtcgttgg ttgcatttaa aataattcct
    2351  tttgtctgtt ggtaatatgg gagatgtatt cagtgcattt attattgaat
    2401  taacttcgga agttactttc tccgtggggt tcaataagaa gaactttttc
    2451  accaattctg gtcgtgtgtt tcctttcgat ggtactattc caaagatcgg
    2501  taactggtta gttgtttatt gtcattggtg gcctgatggt tcaacaacaa
    2551  tacatctgtc aacaaggtct cacggtgtcg acgtcggaaa gtcttgtacg
    2601  ttttcagtga ccggacgtaa cagacgtaaa ttccaagtgg aaagggattt
    2651  gccgatgcgt aacactgttt cttacaggaa tgtgaatttt gaggacggtt
    2701  tcaggatcag atttcctgag tcatctcctt tcacagtcga ttttgttgtg
    2751  tcctttagac ctaacttgtg taagttttct aacgctagtg gttctattat
    2801  tgtagttgga cctaggtttg acgcggcagt tggtttagaa agttatctcg
    2851  atttacttaa aggtcggttg agaatttcgc gctctgtaat acccgtaatt
    2901  gcgttggttg tatctataat aagtgtactt gtgtcaatat ctgggattgt
    2951  tgtgaatgca ttaacaagct ttactccggt agaggatgta gtattggtgt
    3001  gggtggattc aattcataga tttgttgttt acaaacatgg aagatttgac
    3051  atccaatcaa ttagaacagt atcagttgag caagcaaaag cactactagc
    3101  tggtcctaca agtattgaga aattctttcg tgagtacggg tggaaggtgt
    3151  attccccctt cttcactgca cttgactggg accaagtggc taaagacagt
    3201  gtctttgggt cgacgtattc aacttaagca agatgtttgt ctaaggacgt
    3251  tgaaatcaat cacctactga gtaatttctt acctggaaaa ctgtttacgc
    3301  agttagtaaa gatagaaagg aaagttgact ggggttgatt ttgttgagaa
    3351  aatttgttag tatttatgtt aatcacttga tttctctgtt gtgattatag
    3401  ttagtttatc aataatttta cttttggtgt gtacaattgt tgtagccgtg
    3451  gtcaccttta aaaatgtcgt aaacgcgttg aagcaagaaa tcgaggaatc
    3501  taggaacaga ttcgacgagg tcaagctgaa aacatatgtt cgacacctta
    3551  aaagtctcat aattcgaaga cctctaagaa gaaattcaaa ggggacaaag
    3601  aatttgggac accaaaaaga ttttaaagag atgatattcc tttagggatt
    3651  gatcaattat ttactttttg attttatttt aaattgttat ctgtttctgt
    3701  gtatagactg tttgagattg gcgtttggcc gactcattgt cttaccatag
    3751  gggaatggac tttgtttgtg ttgttatttt atttgtattt tattaaaatt
    3801  ctcaatgatc tgaaaaagcc tcgtggctaa gagattattg gggggtgagt
    3851  aagtactttt aaagtgatga tggttacaaa ggcaaaaggg gtaaaacccc
    3901  tcgcctacgt aagcgttatt acgccc