!!NA_SEQUENCE 1.0
ID   TRA272198  standard; RNA; VRL; 2014 BP.
XX
AC   AJ272198;
XX
SV   AJ272198.1
XX
DT   15-FEB-2000 (Rel. 62, Created)
DT   21-JUN-2002 (Rel. 72, Last updated, Version 5)
XX
DE   Tobacco rattle virus (TRV) complete RNA2 genome, isolate Rostock
XX
KW   16K gene; 9k gene; coat protein; cp gene.
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-2014
RA   Adam G.;
RT   ;
RL   Submitted (11-FEB-2000) to the EMBL/GenBank/DDBJ databases.
RL   Adam G., Abteilung Pflanzenschutz, Institut fuer Angewandte Botanik der
RL   Universitaet Hamburg, Marseillerstr. 7, 20355 Hamburg, GERMANY.
XX
RN   [2]
RA   Heinze C., von Bargen S., Sadowska-Rybak M., Willingmann P., Adam G.;
RT   "The RNA2 Sequence of the Tobacco Rattle Virus Potato Isolates, TRV Rostock
RT   and TRV Mirow";
RL   Unpublished.
XX
RN   [3]
RA   Heinze C., von Bargen S., Sadowska-Rybak M., Willingmann P., Adam G.;
RT   "Sequences of Tobacco Rattle Viruses from potato";
RL   J. Phytopathol. 148:547-547(2000).
XX
DR   SPTREMBL; Q9IVZ4; Q9IVZ4.
DR   SPTREMBL; Q9IVZ5; Q9IVZ5.
DR   SPTREMBL; Q9IVZ6; Q9IVZ6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2014
FT                   /country="Germany"
FT                   /db_xref="taxon:12295"
FT                   /virion
FT                   /organism="Tobacco rattle virus"
FT                   /isolate="Rostock"
FT   CDS             474. .1064
FT                   /db_xref="SPTREMBL:Q9IVZ6"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAB75405.1"
FT                   /translation="MGSYGDSFEGKILDDLSQPWCEKHNWADVLRRLSKIKFALQNDRD
FT                   MIPGILEDLTTELPVDEVTRFPLMKIYYSLSKEVMIAIETIHSASSFKRRAEEKNNVNP
FT                   RQRFEADTATTLVTPGGGAIRPAGSGDSALTEDAFSHGKLDDASTAFHKSLAMLKGERL
FT                   KAYTQRGFEKEYGLKWAGSAPATSSGGVKGPVV"
FT   CDS             1110. .1316
FT                   /db_xref="SPTREMBL:Q9IVZ5"
FT                   /gene="9k"
FT                   /product="9K protein"
FT                   /protein_id="CAB75406.1"
FT                   /translation="MLGTNDGENVQCVQLGGESARGQYTSNHVDLFEVRVLFPEVRLYW
FT                   ARDRMEKLQFQHSRPIEPFEWCS"
FT   CDS             1334. .1759
FT                   /db_xref="SPTREMBL:Q9IVZ4"
FT                   /gene="16K"
FT                   /product="16K protein"
FT                   /protein_id="CAB75407.1"
FT                   /translation="MTCVPKGCVNEVTVLGHETCSIGHANKLRKQVADMVGVTRRCAEN
FT                   NCGWFVCVVINDFTFDVYNCCGRSHLEKCRKRFEARNREIWKQIEQIRADKAFATVKKS
FT                   HKSRTSEKKFKGGRDFGTPKRFLRDDVPFGIDQLFAF"
XX
SQ   Sequence 2014 BP; 555 A; 336 C; 503 G; 620 T; 0 other;

  AJ272198  Length: 2014  July 2, 2002 09:24  Type: N  Check: 5167  ..
       1  ataaaacatt gcaccaatgg tgctgccctg gctggggtat gtctttgaac
      51  acagtagaat gtgctaattg acaagttgga gaacgcggta gaacgtactt
     101  atccgacaca gcctttatcc ctcttcacga cgaggttttc gtcgatgtat
     151  ttttagttta gctagatcag taaataaact cttgtcttct catacaagga
     201  aaacctgaga cgtgttaact acgaaagtgt ctattttaaa actgtggaaa
     251  cgctaatcgg cggttctgtg gaatccaaaa acgccaaagt cttcatgatt
     301  ttgtgtgcaa aagtgtgtat aaagctctgg tttgaaaatt gaacttgtcc
     351  ttcttacgat caaaaccatg tcaagaattg tcgtatatga gttgaacaag
     401  tgttcaacta cagcatatta ataatcttta cactgtctac agtgcaacct
     451  caggtagctg cattcattgt cagatgggtt cgtacggtga ttcttttgaa
     501  gggaaaatct tggatgatct gtctcaacca tggtgtgaga agcacaattg
     551  ggccgatgtc ttgagaagac tgtcgaagat caagtttgct ttgcaaaatg
     601  atcgcgacat gatcccaggg attttggaag atctgactac cgaacttccc
     651  gttgatgaag ttacgcgatt tcctttgatg aaaatttatt actcactttc
     701  gaaagaagtc atgattgcta ttgaaacaat tcactctgct tcgtcgttta
     751  aaaggcgtgc tgaagagaag aacaatgtga atccccgtca aagattcgaa
     801  gctgatactg cgaccactct cgtgactccg ggtggtgggg ctattcgtcc
     851  tgctggttcc ggtgattcgg ctttgactga agatgcattt tcacatggta
     901  aacttgatga cgcaagtacg gcttttcaca agtctctagc gatgttgaaa
     951  ggtgaaagat tgaaggcgta tacacaacgt ggttttgaga aggaatatgg
    1001  actgaagtgg gcaggaagtg ctccggcgac ctcctctgga ggggttaagg
    1051  gaccggtcgt gtgactcatt gcgaacgcat cgaggaaggt tctcagagcg
    1101  atcggaagta tgttaggtac taacgatggt gagaacgttc aatgtgtaca
    1151  actcggtggt gagagtgcga gaggacagta cacttctaat catgttgatt
    1201  tgtttgaagt gagagtgctt tttccggaag tacggcttta ttgggctcgt
    1251  gataggatgg agaagttaca atttcaacat tccagaccca ttgaaccatt
    1301  cgagtggtgt tcataaagaa atttattgtc actatgacgt gtgtacccaa
    1351  gggttgtgtg aatgaagtca ctgttcttgg tcacgagacg tgtagtatcg
    1401  gtcatgctaa caagttgcga aagcaagttg ctgacatggt tggtgtcaca
    1451  cgtaggtgtg cggaaaataa ttgtggatgg tttgtctgtg ttgttatcaa
    1501  tgattttact tttgatgtgt ataattgttg tggccgtagt caccttgaaa
    1551  agtgtcgtaa acgttttgaa gcgagaaatc gagagatctg gaaacagatt
    1601  gaacaaattc gagctgataa ggcgtttgct acggttaaaa agtctcataa
    1651  atcgagaacc tctgagaaga aattcaaagg gggaagagat tttgggacac
    1701  caaaaagatt tttaagagat gatgttccat ttggaattga tcagttgttt
    1751  gctttttgat tttattttaa attgttatct gtttctgtgt atagactgtt
    1801  tgagattggc gtttggccga ctcattgtct taccataggg gaacggactt
    1851  tgtttgtgtt gttattttat ttgtatttta ttaaaattct caatgatctg
    1901  aaaaggcttt gttgctaaaa gattattggg gggtgagtaa gtacttttaa
    1951  agtgatgatg gttacgaagg caaaaggggt aagacccctc gcctacgtaa
    2001  gcgttattac gccc