!!NA_SEQUENCE 1.0
ID   LMV78854   standard; mRNA; VRL; 10080 BP.
XX
AC   AJ278854;
XX
SV   AJ278854.1
XX
DT   16-AUG-2000 (Rel. 64, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Lettuce mosaic virus (Isolate AF199) mRNA for polyprotein gene
XX
KW   6K1 protein; 6K2 protein; CI protein; cp; CP protein; HcPro protein;
KW   NIa-Pro protein; NIb protein; P1 protein; P3 protein; polyprotein;
KW   VPg protein.
XX
OS   Lettuce mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Potyvirus.
XX
RN   [1]
RP   1-10080
RA   Krause-Sakate R.;
RT   ;
RL   Submitted (14-AUG-2000) to the EMBL/GenBank/DDBJ databases.
RL   Krause-Sakate R., Departamento de Fitopatologia, Universidade Federal de
RL   Vicosa, Avenida Ph Rolphs / s.n., Vicosa, Minas Gerais, 36571-000, BRAZIL.
XX
RN   [2]
RA   Krause-Sakate R., Redondo E., Richard-Forget F., Jadao A.S.,
RA   Houvenaghel M.C., German-Retana M.C., Candresse T., Zerbini F.M.,
RA   Le Gall C.;
RT   "Molecular mapping of the viral determinants of systemic wilting induced by
RT   aLettuce mosaic virus (LMV) isolate in some lettuce cultivars";
RL   Virus Res. 109(2):175-180(2005).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .10080
FT                   /country="Brazil"
FT                   /db_xref="taxon:12202"
FT                   /mol_type="mRNA"
FT                   /virion
FT                   /organism="Lettuce mosaic virus"
FT                   /isolate="AF199"
FT                   /specific_host="Lettuce"
FT   CDS             104. .9871
FT                   /citation=[2]
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9EAE6"
FT                   /db_xref="HSSP:1LVM"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001456"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR002540"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="UniProt/TrEMBL:Q9EAE6"
FT                   /product="polyprotein"
FT                   /protein_id="CAC03987.1"
FT                   /translation="MATLDNCTQVHHMFAYNREHGTNYTRNHFRRYLAAQRIGFYYDWD
FT                   DDVYECPTCEAIYHSLDEIKNWHECDPPAFDLNDFITDARLKSAPVPDLGPVIIETPQA
FT                   EEKQELNFFAATPAPEVSQWKCRGLQFGSFTELETSEPVVSVPEPKCEEPVRTIAKPEE
FT                   SIEQETCGDGKRLLQAQMEVDKAEQDLAFACLNVSLKPRLEGRTTATIARRRDGCLVYK
FT                   TKSSWSQRKRTKKILKGDTLACKNPYTPAVVDKISIAGGSSASVMHEQQKPKILHTTPS
FT                   RKVATHYKRTVMNQQTLAALIDQVGTILLNAGKEFEVVGRRKQKVTGKGTRHNGVRLVK
FT                   LKTAHEEGHRRRVDIRIPNSLRSIVMRISARGGWHRTWKDSELSPGSSGYVLNSSKIIG
FT                   KFGLRRHSIFIVRGRVDGEVIDSQSKVTHSITHRMVQYSDVARNFWNGYSTCFMHNTPK
FT                   DILHTCTSDFDVKECGTVAALLTQTLFQFGKITCEKCAIEYKNLTRDELATRVNKEIDG
FT                   TIISIQTQHPRFVHVLNFLRLIKQVLNAKNENFGAFQETERIIGDRMDAPFSHVNKLNA
FT                   IVIKGNQATSDEMAQASNHVLEIARYLKNRTENIQKGSLKSFRNKISGKAHLNPSLMCD
FT                   NQLDKNGGFEWGQRSYHAKRFFDGYFETIDPSDGYSKYTIRRNPNGHRKLAIGNLIVST
FT                   NFESHRRSMIGESIEDPGLTNQCVSKEGDAFIYPCCCVTDEYGKPTLSEIKMPTKHHLV
FT                   LGNAGDPKYVDLPKEAEGKMFVAKDGYCYINIFLAMLVDVPEDQAKDFTKMAREIAVKQ
FT                   LGEWPSMMDVATACNILATFHPDTRRSELPRILVDHATKTFHVIDSYGSITTGFHILKA
FT                   NTVTQLVKFAHESLESEMQHYRVGGEPDKAPRKPAGSVPTLGISDLRNLGVESENEEHS
FT                   IRPNLQRLIKAIYRPRMMRSLLTEEPYLLILSIVSPGVLMALYNSGSLERTMHEFLQTD
FT                   QRLSATAQILKHLAKKVSLAKTLTIQNAILEGGAGSLNEILDAPAGRSLSYRLAKQTVE
FT                   VMMARSDMDKELVDVGFSVLRDQKNELIEKSYLMDLEDSWHALPLCGKLSAMRALRRWR
FT                   DTSTPEAIPTGAADLKGRYSISVGSVSKSAILHLKGICSGAVKRVRDKWVGVQVQGVKW
FT                   LAKSVHYMIPELMNVLNVGTLLLTLISLGVAFRNLTGQFKEMKHKETLAKEEELRKRIR
FT                   TYNSTYYEIHGKHADAKQITKFITHHDPKLLEVVEFYEGPEEEEVEHQAKREDQANLER
FT                   IIAFTALVMMMFDSERSDCVYRSLSKLKSLVSTCEDNVRHQSVDEIIDLFDEKKETIDF
FT                   EIEGKELYSSRVVDSTFSKWWDNQLARGNTMAHYRTEGHFMTFTRETAASVAAEIAHNE
FT                   YRDILLQGGVGSGKSTGLPFHLHKKGGVLLIEPTRPLAQNVYKQLGSSPFHLSPNLRMR
FT                   GSCKFGSSQVTVSTSGYALHFIANNAQSLKAYDFIIFDECHVLDASAMAFRCLLQEFEY
FT                   QGKIIKVSATPPGRKLDFKPMHMVDIATENELSIQQFVQGQGTGVNCDATKKGDNILVY
FT                   VSSYNEVDMLSKMLNDKGYKVTKVDGRTMKLGSVEVETVGTPQRKHFVVATNIIENGVT
FT                   LDVDVVVDFGQKVVPILDSEHRMIRYTKKSITYGERIQRVGRVGRNKAGSAIRIGSTEM
FT                   GTEEIPASIATEAAFLCFTYGFPVMTSNVSTSVLGNCTVRQARTMQKFELSPFFMVDLV
FT                   HHDGTMHPAINSLLKQFKLKESDITLSTLAIPNAVTTFWKSAREYNSLGARTTIDDAAK
FT                   IPFMIKDVPEHLQEKLWETIQQYKGDAGFGRCTSANACKIAYTLSVSPFMIPATINKID
FT                   ALMAEERQKMEYFQTVTANTCTISNFSISSIGDMIRSRYSTNHSRENLQKLQVVRDTII
FT                   NFECQAGTSDGGIFDMETAQKLAEEYGCIVVIYHQSKEALSKRLGLKGRWNQSLICKDL
FT                   LVFCGVAIGGTWMMFQSFKDGMADAVRHQGKGKRQRQKLRYRQARDNKVGIEVYGDDAT
FT                   MEHYFGAAYTEKGKKSGKTKGMGTKNRKFVNMYGYNPEDFSFIRFLDPLTGKTMDEQVF
FT                   SDIGLVQDAFGKERLKLLSGGEIESEHMRSGIRAYLVKNLTTAALEIDMTPHNSCQLGI
FT                   KTNNIAGFVDREYELRQTGEARVVAPALIPKDNPITDEDIPVKHESKTLFRGLRDYNPI
FT                   AAAICLLTNESDGMKETMYGIGFGNTIITNQHLFRRNNGVLRVQSRHGEYVLPNTTQLK
FT                   VLPCEGRDIMVIILTPDFPPFPQKLKFRPPIKGEKICLVGSLFQDKSITSTVSETSVTT
FT                   PVDNSFLWKHWITTKDGHCGLPLVSSNDGYIVGIHSATSSRQTQNYHAAMPEDFHQTHL
FT                   VDPVSKPWVKHWKYNPDNMVWGGINLINSTPREPFKINKLVTDLFGDAVQFQSKQDEWF
FT                   ASQLKGNLKAVGKSTSQLVTKHTVKGKCMMFELYLQTHEEEKEFFKPLMGAYQKSRLNR
FT                   EAFTKDIMKYSTPITVGIVDCDTFLKAEEGVIKRLERLGFDGCEYVTDEEAIFQALNMK
FT                   SAVGALYSGKKRDYFEGYGPEEKENILRESCKRLYTGKFGVWNGSLKSELRPMEKVMAN
FT                   KTRVFTAAPLDTLLAGKVCVDDFNNYFYSKNIEAPWTVGMTKFYGGWNELLTKLPDGWV
FT                   YCDADGSQFDSSLSPFLINSVLRIRLKFMEDWDLGEQMLKNLYTEIVYTAILTPDSTIV
FT                   KKFKGNNSGQPSTVVDNTLMVVLAMTYTLHKLGFEDEEQDSMCKYFINGDDLIIAIKPE
FT                   HESLLDQFQHCFKSLGLNYDFNSRTRKKEELWFMSHCGIKKDGIFIPKLEPERIVSILE
FT                   WDRSDQPVHRLEAICAAMIEAWGYDKLTHEIRKFYKWCLEQAPYADLAKAGKAPYIAEC
FT                   ALKRLYTSKEASEAELEKYMEAVRSLVNDEDDDDTDEVYHQVDAKLDAGQGSKTDDKQK
FT                   NSADPKDNIITEKGSGSGQVKKDDDINAGLHGKHTIPRTKAITQKMKLPMIRGKVALNL
FT                   DHLLEYEPNQRDISNTRATQKQYESWYDGVKNDYDVDDNGMQLILNGLMVWCIENGTSP
FT                   NINGTWVMMDGEEQVEYALKPIIEHAKPTFRQIMAHFSDAAEAYIEMRNKKKPYMPRYG
FT                   RLRGLNDMGLARYAFDFYETTSATPNRAREAHNQMKAAALVGTQNRLFGMDGGGSTQEE
FT                   NTERHTAADVNQNMHTLLGVRGLH"
FT   mat_peptide     107. .1414
FT                   /citation=[2]
FT                   /product="P1 protein"
FT   mat_peptide     1415. .2788
FT                   /citation=[2]
FT                   /product="HcPro protein"
FT   mat_peptide     2789. .3922
FT                   /citation=[2]
FT                   /product="P3 protein"
FT   mat_peptide     3923. .4078
FT                   /citation=[2]
FT                   /product="6K1 protein"
FT   mat_peptide     4079. .6007
FT                   /citation=[2]
FT                   /product="CI protein"
FT   mat_peptide     6008. .6166
FT                   /citation=[2]
FT                   /product="6K2 protein"
FT   mat_peptide     6167. .6745
FT                   /citation=[2]
FT                   /product="VPg protein"
FT   mat_peptide     6746. .7474
FT                   /citation=[2]
FT                   /product="NIa-Pro protein"
FT   mat_peptide     7475. .9034
FT                   /citation=[2]
FT                   /product="NIb protein"
FT   mat_peptide     9035. .9868
FT                   /citation=[2]
FT                   /product="CP protein"
XX
SQ   Sequence 10080 BP; 3292 A; 2109 C; 2407 G; 2272 T; 0 other;

AJ278854  Length: 10080  April 19, 2005 08:52  Type: N  Check: 5341  ..
       1  aaaataaaac aacccaacac aactcaagaa aattcataca agcaaacaaa
      51  ttcgcatttt caagcaattc actttcaacc aattacaaca ttttcaatca
     101  caaatggcaa ctctagataa ctgcactcaa gtacaccaca tgttcgccta
     151  caatcgtgaa cacggaacga actacacgag aaaccatttc agaagatact
     201  tagcagccca gcgaataggt ttctattacg attgggacga tgatgtctat
     251  gaatgtccaa cgtgtgaagc tatataccat tctttggacg aaataaagaa
     301  ctggcacgag tgcgatccac cagcattcga tcttaacgat ttcataactg
     351  atgctaggct gaaatcagca ccagttccag atctcggacc ggtgatcatc
     401  gaaaccccac aagcggagga aaaacaagag cttaatttct tcgctgcaac
     451  cccggcacct gaagtttcac aatggaaatg tagagggttg caatttggtt
     501  catttactga acttgaaaca tctgaaccag ttgtttcggt accagaaccc
     551  aagtgtgaag agccggttag gaccatcgca aagccagaag agtcaatcga
     601  acaagagacc tgtggagacg gaaaaagact tcttcaggcg cagatggaag
     651  tcgacaaagc cgaacaagat cttgcattcg cttgcctgaa cgttagccta
     701  aaacctaggt tggagggcag aactactgca actattgcaa gacgcaggga
     751  tggatgtttg gtttataaaa ccaaatcaag ctggtcgcag aggaagagaa
     801  caaagaagat ccttaagggt gataccctag cttgtaaaaa cccatacact
     851  ccagcggttg ttgacaaaat ctcaatcgca ggaggctcat cagccagtgt
     901  gatgcacgaa caacagaaac ctaaaattct gcacactaca ccatcaagaa
     951  aggtggccac gcattataaa cggacggtga tgaaccaaca gacactcgca
    1001  gctcttatag atcaagttgg cacgattcta ctaaacgcag gaaaagagtt
    1051  tgaagtggtg ggccgcagga agcagaaagt aactggcaag ggaactagac
    1101  ataacggtgt gaggctggta aagcttaaaa ctgcacatga ggaagggcat
    1151  cggagaagag tagacatacg catccccaat agcctgcgct caattgttat
    1201  gcgtatttca gctcggggcg gttggcacag aacatggaaa gattcagaac
    1251  tatccccagg atcaagcggt tacgtattga actcgtcaaa aatcatagga
    1301  aaatttggtt taaggcgaca cagcatattc attgttaggg ggagggtaga
    1351  tggtgaagtt atagactcgc aaagtaaggt cacacattcc atcacgcacc
    1401  gtatggttca atacagcgac gtcgcacgaa acttctggaa cgggtactca
    1451  acttgtttca tgcacaatac cccaaaggac atactccata cctgcacatc
    1501  agattttgat gttaaagaat gtggcactgt cgcagcactt ttaactcaaa
    1551  cactgtttca atttgggaaa atcacctgtg aaaagtgcgc aatcgagtac
    1601  aaaaatctaa cgcgagacga gctcgctacg cgtgttaata aggagattga
    1651  tggaaccata atcagcattc aaactcagca tccacgcttc gtgcatgtac
    1701  tcaattttct caggttaatt aaacaagtac tcaatgctaa gaatgagaac
    1751  tttggagcat ttcaagagac ggagaggata attggggatc gaatggatgc
    1801  acctttctca cacgtaaata agctgaatgc tatcgtcatt aaaggtaatc
    1851  aagcaacatc tgatgagatg gcacaagcat cgaaccatgt cctcgaaatc
    1901  gcacgatatc tcaagaaccg aactgagaac atccaaaagg gctcactaaa
    1951  gtcattcagg aacaaaatct ccggtaaggc acacttaaat ccgagtctta
    2001  tgtgtgacaa tcaacttgat aagaacggcg ggtttgaatg ggggcagcga
    2051  agttaccatg ctaaaaggtt tttcgacgga tacttcgaaa ccattgaccc
    2101  atctgatggc tatagcaaat acaccataag acgcaatcca aatggacatc
    2151  gaaagttggc aattggtaat ttgatcgtct ccacgaactt tgaatcacat
    2201  agaagaagca tgattggaga atcaatcgaa gaccctggtc tcactaacca
    2251  gtgcgtgagc aaagagggag atgccttcat ctatccatgc tgctgtgtaa
    2301  cagatgaata tggtaaacca acattatctg agattaaaat gcctacaaag
    2351  catcatctag tcctaggaaa tgccggtgac cccaaatatg tggatttacc
    2401  aaaggaagcg gaaggaaaga tgttcgtagc aaaagacgga tattgttaca
    2451  taaacatctt cttggctatg cttgttgacg tcccagagga tcaagctaaa
    2501  gatttcacga agatggcacg cgagatagca gtgaaacagc tcggggagtg
    2551  gccctcaatg atggatgtag caacggcttg taatatatta gctacatttc
    2601  atccagacac tcgaagatcg gagttacctc gaatcttagt cgaccacgca
    2651  acgaaaacat tccatgtaat tgattcatat ggttcaatca cgactggatt
    2701  ccatattctg aaagccaaca ccgtgacgca actcgtcaag ttcgcgcatg
    2751  agtcactaga atctgagatg caacactaca gagtaggggg ggaaccagat
    2801  aaagcaccca ggaaaccagc tggcagtgtc ccaactctag gaatttcaga
    2851  cctcaggaac cttggagtgg aatcagaaaa cgaagagcac tcaatccggc
    2901  caaatctcca aaggttgatc aaggcgattt acagaccccg aatgatgcgc
    2951  agcctcttaa cagaggaacc atacttgtta atcctaagta ttgtgtcccc
    3001  tggcgttctg atggcactct acaacagtgg ttccttggag cggacaatgc
    3051  atgaattctt gcaaactgac cagagactga gcgccaccgc ccaaatccta
    3101  aaacatctag caaagaaagt ttcactcgca aagacactta cgattcagaa
    3151  tgctatcttg gagggtggag caggatcact gaatgaaatt cttgacgcgc
    3201  ccgcgggacg atccctatcg tatagactag caaagcagac ggtggaggtg
    3251  atgatggcgc ggagcgacat ggataaggaa ctggtggacg ttggatttag
    3301  cgttcttagg gatcagaaga atgaactcat agaaaaaagt tatctcatgg
    3351  atttggagga ctcgtggcac gcactaccat tgtgtggaaa attatcggca
    3401  atgcgagcct tgcggcgatg gcgggacacc tctactcccg aagcaatccc
    3451  gacaggtgcc gcagatttga aaggcagata cagtatctcg gttggatctg
    3501  tttccaaaag cgcgatctta cacctaaagg gaatttgttc aggcgcagta
    3551  aagagagtta gagacaagtg ggtcggagtg caagtgcaag gcgtaaaatg
    3601  gttagctaaa tcagtacact acatgatacc agaactaatg aacgtactga
    3651  atgttggaac tctcctccta acgctgatat cgctaggcgt agcattccgg
    3701  aatttgactg gccagttcaa agagatgaaa cacaaagaaa cgctggcaaa
    3751  ggaggaggaa ctacgtaagc gcatacgcac ctacaatagc acttactacg
    3801  aaatccatgg aaagcacgct gatgccaaac aaatcactaa attcataaca
    3851  caccatgatc caaaactact ggaagtagtt gagttttacg aaggtcctga
    3901  agaagaagaa gtggaacatc aagcaaagcg agaggatcaa gctaatctcg
    3951  aacgcattat cgcttttaca gccttagtga tgatgatgtt tgacagcgag
    4001  agaagtgatt gtgtgtacag gagtctatca aagcttaaat cattagtatc
    4051  aacgtgtgag gataatgtac gccaccagag cgttgatgag atcattgacc
    4101  tgttcgacga gaagaaagaa actatagatt tcgagattga aggaaaggaa
    4151  ctttactctt ctcgcgtggt ggattcgaca ttcagcaagt ggtgggacaa
    4201  tcaattggca cggggcaaca cgatggcaca ttacagaaca gagggacact
    4251  tcatgacgtt cactcgtgaa acagctgcga gcgtggcagc cgaaatagca
    4301  cataacgagt atagagatat tctcttgcaa ggtggtgtcg gctccggcaa
    4351  gtctacaggt ctcccgttcc atttgcacaa gaagggaggt gtactactca
    4401  tcgaaccaac tcgtccgtta gctcaaaatg tatacaagca gcttggaagt
    4451  agcccttttc acctgtcacc aaatttgcgt atgcgaggtt cttgcaagtt
    4501  tggatctagt caggtgactg tgtccacgag tggttatgcc ttacatttca
    4551  tagcgaacaa tgcgcaaagt cttaaggcat atgacttcat catttttgat
    4601  gaatgtcacg tattagatgc cagtgcaatg gcgtttagat gcttactgca
    4651  ggagttcgag tatcaaggga agatcataaa ggtatcagcc acgccaccgg
    4701  gaagaaagct tgacttcaaa ccaatgcaca tggtcgatat tgctacagaa
    4751  aatgaactat cgatacagca attcgtccaa ggtcaaggaa ctggagtaaa
    4801  ctgtgatgca acaaagaaag gagacaatat cttggtctac gtctcaagtt
    4851  acaacgaagt ggacatgttg agcaaaatgt taaacgacaa aggttacaaa
    4901  gtgacaaagg ttgacggtag gacgatgaag ttagggagtg tggaagtaga
    4951  aacagtaggc accccacagc ggaaacactt tgtagtggca accaacatca
    5001  tagaaaatgg cgttacattg gatgtcgatg tcgtggtgga tttcgggcag
    5051  aaggtagttc ccattcttga cagcgagcac cgaatgatcc ggtatacaaa
    5101  gaaaagtatc acatatggtg agcgaatcca aagagtggga agggtcgggc
    5151  gaaacaaagc tggttctgcc atccggatag ggagcactga gatggggacg
    5201  gaagaaatac cggcatcaat cgcaacagaa gcagcctttt tgtgtttcac
    5251  atacggattt cctgtcatga caagcaacgt gagcacaagt gtacttggca
    5301  attgcacagt tagacaagca cggacgatgc aaaagtttga gctgtccccc
    5351  ttctttatgg ttgacttggt acaccacgac ggtacaatgc acccagcaat
    5401  taacagcctc ttgaaacagt tcaaattgaa ggaatcagac atcacactaa
    5451  gcacgctggc aataccgaat gcagtaacca cattctggaa aagcgctcga
    5501  gagtataact ccttaggtgc tcgcacaaca atcgatgacg cagctaaaat
    5551  accatttatg atcaaggatg ttccagaaca cttgcaggaa aagctttggg
    5601  agacaatcca gcagtataag ggtgatgcag gttttggaag atgcacatca
    5651  gctaacgcgt gcaaaatagc atacacactc tctgtgagtc cctttatgat
    5701  cccagcaaca atcaacaaga ttgatgctct gatggccgaa gaacgacaga
    5751  agatggaata tttccaaaca gtcacagcta atacatgtac aatctcaaac
    5801  ttctccatta gtagcattgg cgacatgatc aggtcgagat actcaacaaa
    5851  ccattctaga gagaatctgc agaaactaca agtggtcaga gacacaatca
    5901  tcaacttcga atgtcaagct ggaactagtg atgggggtat tttcgatatg
    5951  gaaacagcac agaaattggc ggaggagtat gggtgcatcg ttgtcattta
    6001  tcaccaatca aaagaggctc ttagtaaacg actcggtctc aaaggcagat
    6051  ggaatcagag cctgatatgc aaagatttac tggttttctg cggcgtagcc
    6101  attggcggca catggatgat gtttcagagc ttcaaggacg ggatggctga
    6151  tgcagttcga caccaaggca aaggtaaacg gcaaagacag aagctccgtt
    6201  atcgacaagc aagggataac aaggtaggca ttgaagttta tggtgacgat
    6251  gcaacgatgg aacactattt tggggctgcg tacacagaga aagggaagaa
    6301  atccggaaaa acgaaaggaa tgggaacgaa aaatcgaaaa tttgtgaaca
    6351  tgtatgggta caacccagaa gatttctcat tcatccgatt tctggaccca
    6401  ctcacaggga aaacaatgga tgaacaagta ttttctgaca taggtctcgt
    6451  ccaagacgcc tttggtaagg aaagactcaa acttctatcc ggaggagaaa
    6501  ttgagtcgga gcacatgcga agtggaatta gagcttatct tgtcaagaat
    6551  cttaccacag cagcactcga aatagacatg acccctcaca actcttgcca
    6601  gctcggaatc aagacaaaca acatagcagg atttgtcgac agggaatacg
    6651  aattgcgtca gaccggagaa gctagggttg ttgctccagc actgattcca
    6701  aaagataatc caatcacgga cgaagatatc cccgtaaagc acgaaagcaa
    6751  aacactgttc aggggcttaa gagattataa ccctatagca gcagcaatat
    6801  gtttgcttac caacgaatcg gacggaatga aagaaacaat gtatggcatt
    6851  ggttttggta acacaattat cacaaaccaa cacctattca ggcgcaacaa
    6901  tggcgtattg agggttcagt cgagacatgg tgaatacgtg cttccaaata
    6951  caacgcagct caaagtactt ccttgcgaag gaagggacat aatggttatc
    7001  attctcacac cagacttccc tccatttcca caaaagctga aattccgtcc
    7051  accgatcaaa ggagagaaga tttgcctcgt tggatcctta tttcaagata
    7101  agagcatcac cagcaccgtg tccgagacga gcgtaacaac acccgtggac
    7151  aacagcttct tgtggaaaca ctggatcact acaaaagatg gacattgcgg
    7201  gcttccgtta gtatcatcaa atgacggata catagtcgga atccacagcg
    7251  ccacaagttc gcgacaaaca cagaattatc atgcagcgat gcccgaagat
    7301  tttcatcaaa cacatcttgt agatccagtc tcaaaaccgt gggtgaaaca
    7351  ttggaagtac aatccagaca acatggtttg ggggggcata aatctcatca
    7401  atagtacccc aagggaaccc ttcaaaataa acaaattagt gacagactta
    7451  ttcggggacg cagtacagtt tcaatccaaa caagacgaat ggttcgcaag
    7501  tcaattgaaa ggcaacttga aagcagtggg gaagagcaca agccaactcg
    7551  taacaaagca cacagtcaag ggtaagtgca tgatgtttga gctatacctg
    7601  caaacacacg aagaggaaaa ggaattcttt aaaccactga tgggagccta
    7651  ccagaagagc cgcttgaaca gagaagcatt cacaaaagac atcatgaaat
    7701  actccacacc gataacagtg ggcatcgttg attgcgacac gtttttgaaa
    7751  gccgaagaag gagttataaa acgcttagag agactcggat tcgatggttg
    7801  cgaatatgtc acagatgaag aagcaatctt tcaagccctg aatatgaagt
    7851  cggctgttgg tgcactatat agtggaaaga agagagatta cttcgagggt
    7901  tacggtccag aagaaaaaga gaatatcttg agggaaagct gcaaacgact
    7951  atatacaggt aagtttggag tgtggaatgg gtcacttaag tcggaactga
    8001  gacctatgga gaaagtcatg gccaataaga cacgtgtttt tacggcagcg
    8051  ccgctcgaca ctctgcttgc tggaaaagtc tgcgtcgatg attttaacaa
    8101  ttacttctac agcaagaaca tagaagcacc ttggacggtt ggcatgacga
    8151  agttttatgg tggttggaat gagctcctta cgaagttacc agatggctgg
    8201  gtttactgcg atgcagatgg atcacaattt gatagttctt tgtcaccatt
    8251  tctcatcaac tcagtgctca gaatacgttt aaaattcatg gaggattggg
    8301  atcttggcga acagatgctc aaaaatctgt acacagaaat tgtatacaca
    8351  gcgatcctca ctccagattc aaccatagtg aagaagttca aggggaataa
    8401  cagcggacag ccatccacgg tagtagacaa cacactgatg gttgtgttag
    8451  ctatgacata cacgctgcac aagttaggct ttgaagacga ggaacaagat
    8501  tctatgtgca agtacttcat caatggagat gacctgatca tcgcgataaa
    8551  accagagcac gaatcattac tggatcagtt ccaacattgt ttcaaaagtt
    8601  tgggcctaaa ttacgatttc aactcacgaa cgaggaaaaa ggaggaattg
    8651  tggttcatgt cacattgcgg catcaagaaa gacggaatct tcatcccaaa
    8701  actcgagcca gagcgcattg tgtcaatcct agagtgggat aggtcggacc
    8751  aaccagtaca tcgcttagag gccatatgtg cagcaatgat cgaagcatgg
    8801  ggttacgaca aattaaccca tgaaattcga aaattctaca agtggtgtct
    8851  ggagcaagca ccatatgctg atttggcgaa agcgggaaaa gcaccgtaca
    8901  tagcagaatg tgctctaaaa cgattgtaca ccagcaagga agccagtgaa
    8951  gcagaattag agaaatacat ggaagctgta cgtagtcttg tcaatgatga
    9001  agatgacgac gatacggatg aggtgtatca tcaagtagat gcgaagcttg
    9051  atgcaggcca aggcagcaag actgatgata aacagaagaa ttcagcggat
    9101  ccaaaggata atatcatcac ggagaaagga agtggttctg ggcaggtgaa
    9151  gaaggatgac gacatcaacg cagggctaca tggtaaacac accatacctc
    9201  gtacaaaggc aatcacacag aaaatgaagt taccaatgat ccgaggtaaa
    9251  gtggctttaa accttgatca tttgctggag tacgaaccaa accagagaga
    9301  catatcgaac acacgtgcaa cccagaaaca gtacgagtca tggtacgacg
    9351  gggttaagaa tgactatgat gtggacgata atggcatgca attaattctg
    9401  aatggactga tggtttggtg tatagaaaac gggacatccc cgaacataaa
    9451  tggaacatgg gtgatgatgg atggtgaaga acaagtggaa tatgctctga
    9501  aacccatcat cgaacacgca aaacccacgt ttcgccagat aatggcccat
    9551  ttcagtgacg cagccgaggc gtacattgaa atgagaaaca agaagaaacc
    9601  gtatatgcca cgatacggac ggctacgagg cttgaacgat atggggctag
    9651  ctcgctatgc tttcgacttc tacgaaacaa catcagcgac cccaaatcgg
    9701  gcgagagagg cgcacaatca aatgaaggca gctgctcttg tgggaacaca
    9751  gaacagattg tttggaatgg atggaggcgg ttcaacccag gaagagaaca
    9801  cggagaggca cacagccgca gatgttaatc agaatatgca tactctctta
    9851  ggcgtgagag ggttgcacta aaggcgtgtg ttggcattta aagactgtag
    9901  tataaatcta taatatagtg agtgtttcac tccttttatg tttatgtatg
    9951  cacttatttg tccgttagta ttctctccct gtacttcgct cgtgagggcg
   10001  taggttcagc tgagggcttt tctagtttcc gctgtgaggt tttacctcga
   10051  aggttgctag tctggttttc agtcggagac