!!NA_SEQUENCE 1.0
ID   LMO306288  standard; genomic RNA; VRL; 10080 BP.
XX
AC   AJ306288;
XX
SV   AJ306288.1
XX
DT   01-FEB-2003 (Rel. 74, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Lettuce mosaic virus complete genomic RNA, Yuhang isolate
XX
KW   6K1 protein; 6K2 protein; CI protein; coat protein; HC-Pro protein;
KW   NIa-protease; NIa-Vpg protein; NIb polymerase; P1 protein; P3 protein.
XX
OS   Lettuce mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Potyvirus.
XX
RN   [1]
RP   1-10080
RA   Adams M.J.;
RT   ;
RL   Submitted (01-FEB-2001) to the EMBL/GenBank/DDBJ databases.
RL   Adams M.J., Plant Pathology Department, IACR-Rothamsted, Harpenden, Herts
RL   AL5 2JQ, UNITED KINGDOM.
XX
RN   [2]
RA   Zheng T., Chen J., Adams M.J.;
RT   "Characterisation of a lettuce mosaic virus isolate from China";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .10080
FT                   /country="China:Zhejiang"
FT                   /db_xref="taxon:12202"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Lettuce mosaic virus"
FT                   /isolate="Yuhang"
FT                   /specific_host="Lettuce"
FT   5'UTR           1. .103
FT   CDS             104. .9871
FT                   /db_xref="GOA:Q80P68"
FT                   /db_xref="HSSP:1LVM"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001456"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR002540"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="UniProt/TrEMBL:Q80P68"
FT                   /note="ORF1"
FT                   /product="polyprotein"
FT                   /protein_id="CAC83742.1"
FT                   /translation="MATLDNCTQVHHMFAYNREHGTNYTRNHFRRYLAAQRIGFYYDWD
FT                   DDVYECPTCEAIYHSLDDIKNWHECDPPAFDLNDFITDARLKSAPVPDLGPVIIETPKA
FT                   EEKQEFNFFAATPAPEVSQWKCRGLQFGSFTELEAPEPVISAPEPKCEEPAMTIAKPEE
FT                   SVEQETRGDGKRLLQAQMEVDKAEQDLAFACLNASLKPRLEGRTTATIARRRDGCLVYK
FT                   TKPSWSQRKSTKKTFKVDTLACKNPYIPAVVDKISIAGGSSASVMHEQQKPKILHTTPS
FT                   RKVATHYQRTVMDQQTLTAFIEQVGTILLNAEKEFEVVGCRKQKVTGKGARHNGVRLVK
FT                   LKTAHEEGHRRRVDIRIPNGLRSIVMRISARGGWYKTWKDSELSPGSSGYVLNSSKIIG
FT                   KFGLRRHSIFVVRGRVDGEIIDSQSKVTHSITHRMVQYSDVARNFWNGYSTCFMHNTPK
FT                   DILHTCTSDFDVKECGIVAALLTQTLFQFGKITCEKCAIEYKNLTRDELAARVNKEIDG
FT                   TIISIQTQHPRFVHVLNFLRLIKQVLNAKNENFGAFQETERIIGDRMDAPFSHVNKLNA
FT                   IVIKGNQATSDEMAQASNHVLEIARYLKNRTENIQKGSLKSFRNKISGKAHLNPSLMCD
FT                   NQLDKNGGFEWGQRSYHAKRFFDGYFETIDPSDGYSKYTIRRNPNGHRKLAIGNLIVST
FT                   NFESHRRSMIGESIEHPGLTNQCVSKEGDAFIYPCCCVTDEYGKPTLSEIKMPTKHHLV
FT                   LGNAGDPKYVDLPKEAEGKMFVTKDGYCYINIFLAMLVDVPEDQAKDFTKMAREIAVKQ
FT                   LGEWPSMMDVATACNILATFHPDTRTSELPRILVHHATKTFHVIDSYGSITTGFHILKA
FT                   NTVTQLVKFAHESLESEMQHYRVGGEPDKAPRKPAGSVPTLGISDLRDLGVELENEEHS
FT                   IRPNLQRLIKAIYRPRMMRSLLTEEPYLLILSIVSPGVLMALYNSGSLERTMHEFLQTD
FT                   QRLSATAQILKHLAKKVSLAKTLTIQNAILEGGAGSLNEILDAPAGRSLSYRLAKQTVE
FT                   VMMARSDMDKELVDVGFSVLRDQKNELIEKSYLMDLEDSWHALPLCGKLSAMRASRRWR
FT                   DTSTPEVIPTGAADLKGRSSISVGSVSKSAILHLKGICPGAVKRVRDKWVGVQVQGVKW
FT                   LAKSVHYMIPELTNILNVGTLLLTLISLGVAFRNLTGQFKEMKHKETLAKEEELRKRIR
FT                   TYNSTYYEIHGKHADAKQITKFITHHDPKLLEVVEFYEGPEEEEVEHQAKREDQANLER
FT                   IIAFTALVMMMFDSERSDCVYRSLSKLKSLVSTCEDDVRHQSVDEIIDLFDEKKESIDF
FT                   EIEGKELYSSRVVDSTFSKWWDNQLVRGNTMAHYRTEGHFMTFTRETAASVAAEIAHNE
FT                   YRDILLQGGVGSGKSTGLPFHLHRKGGVLLIEPTRPLAQNVYKQLGSSPFHLSPNLRMR
FT                   GSCKFGSSQVTVATSGYALHFIANNAQSLKAYDFIIFDECHVLDASAMAFRCLLQEFEY
FT                   QGKIIKVSATPPGRKLDFKPMHMVDIATENELSIQQFVQGQGTGVNCDATKKGDNILVY
FT                   VSSYNEVDMLSKMLNDKGYKVTKVDGRTMKLGSVEVETVGTPQRKHFVVATNIIENGVT
FT                   LDVDVVVDFGQKVVPILDSEHRMIRYTKKSITYGERIQRVGRVGRNKAGSAIRIGSTEM
FT                   GTEEIPASIATEAAFLCFTYGFPVMTSNVSTSVLGNCTVRQARTMQKFELSPFFMVDLV
FT                   HHDGTIHPAINSLLRQFKLKESDIKLSTLAIPNAVTTFWKSAREYNSLGARTTIDDAAK
FT                   IPFMIKDVPEHLQEKLWETIQQYKGDAGFGRCTSANACKIAYTLSVSPFMIPATINKID
FT                   ALMAEERQKMEYFQTVTANTCTISNFSISSIGDMIRSRYSTNHSRENLQKLQAVRDTII
FT                   NFECQAGTGDGGSFDMETAQKLAEEYGCIDVIYHQSKEALSKRLGLKGRWNQSLICKDL
FT                   LVFCGVAIGGTWMMFQSFKDGMADAVRHQGKGKRQRQKLRYRQARDNKVGIEVYGDDAT
FT                   MEHYFGAAYTEKGKKSGKTKGMGTKNRRFVNMYGYNPEDFSFIRFLDPLTGKTMDEQVF
FT                   SDISLVQDAFSKERLKLLSEGEIESEHMRNGIRAYLVKNLTTAALEIDMTPHNSCQLGA
FT                   KTNNIAGFVDREYELRQTGEARVVAPALIPKDNPITDEDIPVKHESKTLFRGLRDYNPI
FT                   AAAICLLTNESDGMKETMYGIGFGNTIITNQHLFRRNNGVLRVQSRHGEYVLPNTTQLK
FT                   VLPCEGRDIMVIILTPDFPPFPQKLKFRPPIKGEKICLVGSLFQDKSITSTVSETSVTT
FT                   PVDNSFLWKHWITTKDGHCGLPLVSSNDGYIVGIHSATSSRQTQNYHAAMPEDFHQTHL
FT                   IDPASKSWVKHWKYNPDNMVWGGINLINSAPREPFKINKLVTDLFGDAVQFQSKQDEWF
FT                   ASQLKGNLKAVGKSTSQLVTKHTVKGKCMMFELYLQTHEEEKEFFKPLMGAYQKSRLNR
FT                   EAFTKDIMKYSTPITVGIVDCDTFLKAEEGVIKRLERLGFSGCEYVTDEEAIFQALNMK
FT                   AAVGALYSGKKRDYFEGYGPEEKENILRESCKRLYTGKFGVWNGSLKSELRPMEKVMAN
FT                   KTRVFTAAPLDTLLAGKVCVDDFNNYFYSKNIEAPWTVGMTKFYGGWNELLTKLPDGWV
FT                   YCDADGSQFDSSLSPFLINSVLRIRLKFMEDWDLGEQMLKNLYTEIVYTAILTPDSTIV
FT                   KKFKGNNSGQPSTVVDNTLMVVLAMTYTLHKLGFEDEEQDSMCKYFVNGDDLIIAIKPE
FT                   HESLLDQFQHCFKSLGLNYDFNSRTRKKEELWFMSHCGIQKDGIFIPKLEPERIVSILE
FT                   WDRSDQPVHRLEAICAAMIESWGYDKLTHEIRKFYKWCLEQAPYADLAKAGKAPYIAEC
FT                   ALKRLYTSKEASEAELEKYMEAIRNLVNDEDDDDMDEVYHQVDAKLDAGQGSKTDDKQK
FT                   NSADPKDNIITEKGSGSGQMKKDDDINAGLHGKHTIPRTKAITQKMKLPMIRGKVALNL
FT                   DHLLEYEPNQRDISNTRATQKQYESWYDGVKNDYDVDDSGMQLILNGLMVWCIENGTSP
FT                   NINGTWVMMDGEEQVEYALKPIIEHAKPTFRQIMAHFSDAAEAYIEMRNKKKPYMPRYG
FT                   RLRGLNDMGLARYAFDFYETTSATPNRAREAHNQMKAAALVGTQNRLFGMDGGGSTQEE
FT                   NTERHTAADVNQNMHTLLGVRGLH"
FT   mat_peptide     104. .1414
FT                   /product="P1 protein"
FT   mat_peptide     1415. .2788
FT                   /product="HC-Pro protein"
FT   mat_peptide     2789. .3922
FT                   /product="P3 protein"
FT   mat_peptide     3923. .4078
FT                   /product="6K1 protein"
FT   mat_peptide     4079. .6007
FT                   /product="CI protein"
FT   mat_peptide     6008. .6166
FT                   /product="6K2 protein"
FT   mat_peptide     6167. .6745
FT                   /product="NIa-VPg protein"
FT   mat_peptide     6746. .7474
FT                   /product="NIa-protease"
FT   mat_peptide     7475. .9034
FT                   /product="NIb polymerase"
FT   mat_peptide     9035. .9868
FT                   /product="coat protein"
FT   3'UTR           9872. .10080
XX
SQ   Sequence 10080 BP; 3297 A; 2114 C; 2397 G; 2272 T; 0 other;

AJ306288  Length: 10080  April 19, 2005 08:52  Type: N  Check: 6656  ..
       1  aaaataaaac aacccaacac aactcaagaa aattcataca aacaagcaaa
      51  ttcgcatttt caagcaattt actttcaagc attaacaaca ttttcaatca
     101  caaatggcaa ctctagacaa ctgcactcaa gtacaccaca tgttcgctta
     151  caaccgcgaa cacggaacaa actacacgag gaaccatttt agaagatacc
     201  tagcagctca gcgaataggt ttctattatg attgggacga tgatgtctat
     251  gaatgtccaa cgtgtgaagc tatataccat tctttggatg acataaagaa
     301  ctggcacgag tgcgatccac cagcattcga ccttaacgac ttcataactg
     351  atgctaggct gaaatcagca ccagttccag atcttggacc ggtgatcatt
     401  gaaaccccaa aagcggagga aaaacaagag tttaacttct tcgctgcaac
     451  tccggcacct gaagtgtcac aatggaaatg tagagggttg caatttggtt
     501  cgttcactga acttgaagca cctgaaccag ttatttcggc accagagcct
     551  aagtgtgaag agccggctat gaccatcgca aagccagaag agtcagtcga
     601  acaagagacc cgtggagatg gaaaaagact tcttcaggcg cagatggaag
     651  tcgacaaagc cgaacaagat cttgcattcg cttgcctgaa cgctagccta
     701  aaacctaggt tggagggcag aactactgca actattgcaa gacgcaggga
     751  cggatgtttg gtttataaaa ccaaaccaag ctggtcgcag aggaagagca
     801  caaagaagac ctttaaggtt gacaccctag cttgcaaaaa cccatacatt
     851  ccagcggttg ttgacaagat ctcaatcgca ggaggctcat cagctagtgt
     901  gatgcacgaa caacagaaac ctaaaattct gcacactaca ccatcaagga
     951  aggtggccac gcattatcaa cggacggtga tggatcaaca aacactcacg
    1001  gcttttatag aacaagttgg cacgattcta ctaaacgcag agaaagagtt
    1051  tgaagtggta ggctgcagaa aacaaaaagt gactggcaaa ggagctagac
    1101  ataatggtgt gaggctggta aagcttaaaa ctgcacatga ggaagggcat
    1151  cggagaagag tagatatacg catccccaat ggcctgcgct caattgttat
    1201  gcgtatttca gctcggggcg gttggtacaa aacatggaaa gactcagaac
    1251  tatccccagg atcaagcggc tacgtattga actcgtcaaa aatcatagga
    1301  aaatttggtt taaggcgaca tagtatattc gtagttaggg ggagggtaga
    1351  tggtgaaatt atagattcgc aaagtaaggt tacacactcc atcacgcacc
    1401  gtatggttca atacagtgac gtcgcacgaa acttctggaa cggatactca
    1451  acttgtttca tgcacaacac tccaaaggac atactccata cctgcacatc
    1501  agattttgat gttaaagaat gtggcattgt cgcagcactt ttaactcaaa
    1551  cactgtttca atttgggaaa atcacctgtg aaaagtgcgc aatcgagtac
    1601  aaaaatttaa cgcgagatga gcttgctgca cgtgtcaata aggagattga
    1651  tggaaccata atcagtattc aaactcagca tccacgcttc gtgcatgtac
    1701  tcaattttct caggttaatt aaacaagtgc tcaatgctaa gaatgagaat
    1751  tttggggcat ttcaagagac ggagaggata attggggatc gaatggatgc
    1801  acctttctca cacgtaaata agctgaatgc tatcgtcata aaaggaaatc
    1851  aagcaacgtc tgatgagatg gcacaagcat cgaaccatgt cctcgaaatc
    1901  gcacgatatc tcaagaaccg gactgagaac atccaaaagg gctcgctaaa
    1951  gtcattcagg aacaaaatct ccggtaaggc acacttaaat ccgagtctta
    2001  tgtgtgacaa tcaacttgat aagaacggcg gttttgaatg ggggcagcga
    2051  agttaccatg ccaaaaggtt tttcgacggg tacttcgaaa ccattgaccc
    2101  gtccgatggc tatagcaaat acaccataag acgcaatcca aatggacatc
    2151  gaaagttggc aattggtaat ttgatcgtct ccacaaactt tgaatcacat
    2201  agaagaagca tgattggaga atcgattgaa catcctggtc tcactaacca
    2251  gtgcgtgagc aaagagggag atgctttcat ctatccatgc tgctgtgtaa
    2301  cagatgaata tggtaaacca acattatctg agattaaaat gcctacaaag
    2351  catcacctag tcctaggaaa tgccggtgac cccaaatatg tggatttacc
    2401  aaaggaagcg gaaggaaaga tgttcgtaac aaaagacgga tattgttaca
    2451  taaacatctt cttggctatg cttgttgacg tcccagagga tcaagccaag
    2501  gatttcacaa agatggcacg cgagatagca gtgaaacagc tcggagagtg
    2551  gccctcaatg atggatgtgg caacagcttg caatatatta gctacatttc
    2601  atccagatac ccgaacatcg gagttacctc gaatcttagt ccatcacgca
    2651  acgaaaacat tccatgtaat tgactcatat ggttcaatca cgactggatt
    2701  ccatattctg aaagccaaca ccgtgacgca actcgtcaag ttcgcacatg
    2751  agtcactaga atctgagatg caacactaca gagtaggggg ggaaccagat
    2801  aaagcaccca ggaaaccagc tggtagtgtc ccaactctag gaatttcaga
    2851  cctcagggac cttggagtgg aattagaaaa cgaagagcac tcaatccggc
    2901  caaatctcca aaggttgatc aaggcgattt acagaccccg aatgatgcgc
    2951  agcctcttaa cagaggaacc atacttgtta atcctaagta ttgtgtcccc
    3001  tggcgttctg atggcactct acaacagtgg ttccttggag cggacaatgc
    3051  atgaattctt gcaaactgat cagagactga gcgccaccgc ccaaatccta
    3101  aaacatctag caaagaaagt ttcactcgca aagacactta caatccagaa
    3151  tgctatcttg gagggtggag caggatcact gaatgagatt cttgacgcgc
    3201  ctgcgggacg atccctatcg tacagactgg caaaacagac ggtggaggtt
    3251  atgatggcgc ggagcgacat ggataaggaa ctggtggacg ttggatttag
    3301  cgttcttagg gaccagaaga atgaactcat agaaaaaagt tatctcatgg
    3351  atttggagga ttcgtggcac gcactaccat tgtgtggaaa attatcagca
    3401  atgcgagcct cgcggcgatg gcgggatact tctactccag aagtaatccc
    3451  aacaggcgcc gcagatttga aaggcagatc cagtatctcg gttggatctg
    3501  tttccaaaag cgcgatcttg cacctaaagg gaatttgccc aggcgcagta
    3551  aagagagtta gagacaagtg ggtcggagtg caagtgcaag gcgtaaaatg
    3601  gttagctaaa tcagtgcact acatgatacc agaactaacg aacatattga
    3651  acgttggaac tctcctccta acactgatat cgctaggcgt agcattccgg
    3701  aacctgactg gccagtttaa agagatgaag cataaagaga cgttggcaaa
    3751  ggaggaggaa ctacgtaagc gcatacgcac ctacaatagc acttattacg
    3801  aaatccacgg aaagcacgct gatgccaaac aaatcactaa gttcataaca
    3851  caccatgatc caaaactact agaagtagtt gaattttacg aaggtcctga
    3901  agaagaagaa gtagagcatc aagcaaagcg agaggatcaa gctaatctcg
    3951  aacgcattat cgctttcaca gctttggtga tgatgatgtt tgatagcgag
    4001  agaagtgatt gtgtgtacag gagtctatca aagctcaaat cattagtatc
    4051  tacgtgcgag gatgatgtac gccaccagag cgttgacgag atcattgacc
    4101  tgtttgatga gaagaaagaa tctatagatt tcgagattga aggaaaagaa
    4151  ctttactctt ctcgcgtggt ggattcgaca ttcagtaagt ggtgggacaa
    4201  ccaattagta cgaggcaaca cgatggcaca ctacagaaca gaggggcact
    4251  tcatgacgtt cactcgtgaa acagctgcga gcgtggcagc cgaaatagca
    4301  cataacgagt atagagatat cctcttgcaa ggtggtgtcg gctccggtaa
    4351  gtccacaggc ctcccatttc atttacacag gaaaggaggt gtactactca
    4401  tcgaaccaac tcgtccgtta gctcaaaacg tatacaagca gcttggaagt
    4451  agtccttttc acctgtcacc aaatttgcgc atgcgaggtt cttgcaagtt
    4501  tggatctagt caggtaactg tggccacgag tggttatgcc ttacatttca
    4551  tagcgaacaa tgcgcaaagt cttaaggcat atgactttat cattttcgat
    4601  gaatgtcacg tattagacgc cagtgcaatg gcgtttagat gcttgctgca
    4651  ggagttcgag tatcaaggga agatcataaa ggtatcagct acgccaccgg
    4701  gaaggaagct tgacttcaaa ccaatgcaca tggtcgatat tgctacagaa
    4751  aatgaactat cgatacagca attcgtccaa ggtcaaggaa ctggagtgaa
    4801  ctgtgatgca acaaagaaag gagacaacat cttggtctac gtctcaagtt
    4851  acaacgaagt agacatgttg agcaaaatgt taaacgacaa aggttacaaa
    4901  gtgacaaagg ttgatggtag gacgatgaag ttagggagtg tggaagtaga
    4951  aacagtaggc accccgcagc ggaaacactt tgtagtagca accaacatca
    5001  tagaaaatgg cgttacattg gatgtcgatg ttgtggtgga tttcggacag
    5051  aaggtagtcc ccattcttga tagtgagcac cgaatgattc ggtatacaaa
    5101  gaaaagtatt acatatggtg agcgcattca aagagtggga agggttgggc
    5151  gaaacaaagc tggttctgcc atccggatag gaagcactga gatggggacg
    5201  gaagaaatac cagcatcaat cgcaacagaa gcagcctttt tgtgtttcac
    5251  atacggattt cctgtcatga caagcaacgt gagcacaagt gtacttggca
    5301  attgcacagt aagacaagca cggacgatgc aaaagtttga gctgtccccc
    5351  ttctttatgg ttgacttggt acaccacgac ggtacaatac acccagcaat
    5401  taatagcctc ctgagacagt tcaagttgaa ggaatcagac atcaaactaa
    5451  gcacgctggc aataccgaat gcagtgacca cattctggaa aagcgctcga
    5501  gagtacaact ccttaggtgc tcgcacaaca atcgatgacg cagctaaaat
    5551  accatttatg atcaaggacg ttccagaaca cttgcaggaa aagctttggg
    5601  agacaatcca gcagtataag ggtgatgcgg gttttgggag atgtacatca
    5651  gctaatgcgt gcaaaatagc atacacactc tctgtgagtc ccttcatgat
    5701  tccagcaaca atcaacaaga ttgatgccct gatggccgaa gaacgacaaa
    5751  agatggaata cttccaaaca gtcacagcta acacatgtac aatctcaaac
    5801  ttctccatta gtagtattgg tgacatgatc aggtcgagat actcaacaaa
    5851  ccattctaga gagaacctgc aaaaactaca agcagtcaga gacacaatca
    5901  tcaacttcga gtgccaggct ggaactggtg atgggggttc cttcgacatg
    5951  gagacagcac agaaattggc agaggagtat ggatgcatcg atgtcattta
    6001  tcaccaatcg aaagaagctc tcagtaaacg actcggtctc aaaggcagat
    6051  ggaatcagag cctgatatgc aaagatttat tggtcttctg cggcgtagcc
    6101  attggcggca catggatgat gtttcagagc ttcaaggacg ggatggctga
    6151  tgcagttcga caccaaggca aaggtaaacg gcaaagacag aagctccgtt
    6201  atcgacaagc aagggacaac aaggtaggca ttgaagttta tggtgacgat
    6251  gcgacgatgg aacactattt tggagctgcg tatacggaga aagggaagaa
    6301  atccggaaaa acgaaaggaa tgggaactaa aaatcgaaga tttgtaaata
    6351  tgtacggata caatccagaa gatttctcat tcatccgatt tctggacccg
    6401  ctcacaggga aaacaatgga cgaacaagta ttttctgaca taagtcttgt
    6451  ccaagatgcc tttagtaagg aaagactcaa actcctatcc gaaggagaaa
    6501  tcgaatcgga gcacatgcga aacggaatta gagcttatct tgttaagaat
    6551  cttaccacag cagcactcga gatagacatg actcctcaca actcttgcca
    6601  gctcggagcc aagacaaaca acatagcagg atttgtcgac agagaatatg
    6651  aattgcgtca gaccggagaa gctagggttg ttgctccagc actgattcca
    6701  aaggacaatc caatcacgga cgaagatatc cctgtaaagc acgaaagcaa
    6751  aacactgttc aggggcttaa gagattacaa ccctatagca gcagcaatat
    6801  gcttgcttac caacgaatcg gatggaatga aagagacaat gtatggcatt
    6851  ggttttggta acacaattat tacaaaccaa cacctattca ggcgcaacaa
    6901  tggcgtattg agggttcaat cgagacatgg tgaatacgtg cttccgaata
    6951  caacgcagct caaagtactt ccttgtgaag gaagggacat aatggttatc
    7001  attctcacac cagacttccc tccgtttcca caaaagctga aattccgtcc
    7051  accgatcaaa ggagagaaga tttgcctcgt tggatcctta ttccaggata
    7101  agagcatcac cagcaccgta tctgagacga gcgtgacaac accagtggac
    7151  aacagcttct tgtggaaaca ctggatcact acaaaagatg gacattgcgg
    7201  acttccacta gtatcatcaa atgatggata catagtcgga atccacagtg
    7251  ctacgagttc acgacaaaca cagaactatc atgcagcgat gcccgaagat
    7301  tttcatcaaa cacatcttat agatccagct tcaaaatcgt gggtgaaaca
    7351  ttggaaatac aatccagata acatggtttg ggggggcata aatctcatca
    7401  atagtgcccc aagggaaccc ttcaaaataa acaaattagt gacagactta
    7451  ttcggagacg cagtacagtt tcaatccaaa caagacgaat ggtttgcaag
    7501  tcaattgaaa ggcaacttga aggcagtggg gaagagcaca agccaactcg
    7551  tgacaaagca cacagtcaag ggtaagtgca tgatgtttga gctatacctg
    7601  caaacacacg aagaggaaaa ggagttcttc aaaccactga tgggagccta
    7651  ccagaagagc cgcttgaaca gagaagcatt cacaaaagac atcatgaaat
    7701  actccacacc gataacagtg ggcatcgtcg attgcgacac gtttttgaag
    7751  gccgaagaag gagtcataaa acgcttagag agactcggat tcagtggttg
    7801  cgaatatgtt acagatgaag aggcaatctt tcaagccctg aatatgaagg
    7851  cggctgttgg tgcactatat agtggaaaga agagggatta cttcgagggc
    7901  tacggtccag aagaaaaaga gaatatcttg agagaaagtt gcaaacggct
    7951  atatacaggt aagtttggag tttggaatgg gtcactcaag tcggaactga
    8001  gacctatgga aaaagtcatg gccaataaga cacgtgtctt tacggcagcg
    8051  ccactcgaca ctctgcttgc tggaaaagtc tgcgttgatg actttaacaa
    8101  ctacttctac agcaaaaaca tcgaagcacc ttggacagtt ggtatgacga
    8151  agttttatgg tggttggaat gagctcctca cgaagttacc agatggctgg
    8201  gtttattgcg atgcagatgg atcacaattt gatagttctt tgtcaccatt
    8251  tctcatcaac tcagtgctca gaatacgttt aaaattcatg gaggattggg
    8301  atcttggtga acagatgctc aaaaatctgt acacagaaat tgtatacaca
    8351  gcgatcctca ctccagactc aaccatagtg aagaagttca agggaaataa
    8401  cagcggacag ccatccacgg tagtagacaa cacattgatg gttgtgttgg
    8451  ctatgacata cacgctgcac aagttaggct ttgaagatga ggaacaagac
    8501  tctatgtgca aatacttcgt caatggagac gacctgatca tcgcgataaa
    8551  accagaacac gaatcattac tggatcagtt ccaacactgt ttcaaaagtt
    8601  tgggcctaaa ttacgatttc aactcacgaa cgaggaagaa ggaagaattg
    8651  tggttcatgt cacattgcgg catccagaaa gacggaattt tcattccaaa
    8701  actcgaacca gagcgcattg tgtcaatcct agagtgggat aggtcagacc
    8751  agccagtgca tcgcttagag gccatatgtg cagcaatgat cgaatcatgg
    8801  ggttacgaca aattaaccca tgaaattcga aaattctaca agtggtgcct
    8851  ggaacaagcg ccatatgctg atttggcgaa agcgggaaaa gcaccgtaca
    8901  tagcagagtg cgctcttaaa cgactataca ccagcaagga agccagcgaa
    8951  gcggagttag aaaaatacat ggaagctata cgcaatcttg tcaatgatga
    9001  agatgacgat gatatggatg aggtctatca tcaagtagac gcaaagcttg
    9051  atgcaggcca aggcagtaaa actgatgata agcaaaagaa ctcagcggat
    9101  ccaaaggata atatcatcac agagaaagga agtggttctg ggcagatgaa
    9151  gaaggatgac gacatcaacg cagggctaca tggaaaacac accatacctc
    9201  gtacaaaggc aatcacacag aaaatgaagt taccaatgat ccgaggtaaa
    9251  gtggctttaa accttgatca tttgctggag tacgaaccaa accagagaga
    9301  catatcgaac acacgtgcaa cccagaaaca gtacgagtca tggtacgacg
    9351  gggttaagaa tgactacgat gtggatgata gtggcatgca attaattctg
    9401  aacggattga tggtttggtg tatagaaaac gggacatccc cgaatataaa
    9451  tggaacatgg gtgatgatgg atggcgaaga acaagtagaa tatgctctaa
    9501  aacccatcat cgaacacgcg aaacccacgt ttcgccagat aatggcccac
    9551  ttcagtgacg cagccgaggc gtacattgag atgagaaaca agaagaaacc
    9601  gtatatgcca cgatacggac ggctacgagg cttgaacgat atggggctag
    9651  ctcgctatgc tttcgacttc tacgaaacaa catcagcgac cccaaatcgg
    9701  gcaagagagg cgcacaatca aatgaaggca gctgctctag tgggaacaca
    9751  gaacagactg tttggaatgg acggaggcgg ttcaacccag gaagagaaca
    9801  cggagaggca cacagccgca gatgtaaatc agaatatgca tactctctta
    9851  ggcgtgagag ggttgcacta aaggcgtgtg ttggcattta aagactgtag
    9901  tataaatcta taatatagtg agtgtttcac tccttttatg tttatgtatg
    9951  cacttatttg tccgttagta ttctctccct gtacttcgct cgtgagggcg
   10001  taggttcagc tgagggcttt tctagtttcc gctgtgaggt tttacctcga
   10051  aggttgctag tctggttttc agtcggagac