!!NA_SEQUENCE 1.0
ID   AY224663   standard; genomic RNA; VRL; 8184 BP.
XX
AC   AY224663;
XX
SV   AY224663.1
XX
DT   23-APR-2003 (Rel. 75, Created)
DT   11-OCT-2003 (Rel. 77, Last updated, Version 2)
XX
DE   Citrus psorosis virus segment RNA1, complete sequence.
XX
KW   .
XX
OS   Citrus psorosis virus
OC   Viruses; ssRNA negative-strand viruses; Ophiovirus.
XX
RN   [1]
RP   1-8184
RX   MEDLINE; 22832467.
RX   PUBMED; 12951265.
RA   Naum-Ongania G., Gago-Zachert S., Pena E., Grau O., Garcia M.L.;
RT   "Citrus psorosis virus RNA 1 is of negative polarity and potentially
RT   encodes in its complementary strand a 24K protein of unknown function and
RT   280K putative RNA dependent RNA polymerase";
RL   Virus Res. 96(1-2):49-61(2003).
XX
RN   [2]
RP   1-8184
RA   Naum G., Gago-Zachert S., Pena E., Grau O., Garcia M.L.;
RT   ;
RL   Submitted (24-JAN-2003) to the EMBL/GenBank/DDBJ databases.
RL   Facultad de Ciencias Exactas, Universidad Nacional de La Plata, Instituto
RL   de Bioquimica y Biologia Molecular, Calles 47 y 115, La Plata, Buenos Aires
RL   1900, Argentina
XX
DR   SPTREMBL; Q80H97; Q80H97.
DR   SPTREMBL; Q80H98; Q80H98.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8184
FT                   /db_xref="taxon:73561"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus psorosis virus"
FT                   /segment="RNA1"
FT   CDS             complement(167. .7417)
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q80H98"
FT                   /product="280 kDa protein"
FT                   /protein_id="AAO34632.1"
FT                   /translation="MEWSDEKASSKITLEDEIEIVTSDIIASEDTAIELAKKEEEIKKA
FT                   LESRKSYTEEYTNLIKEMKDYPSAYSILSGKKEEYIMLRIAQDHEKSLEPKKEEINYTS
FT                   MLKYWINWDHLTYVGTYVDRPSLISRLDSPYKTIPKETIEDFIYREDYPEKFGVRSKID
FT                   LFRLREFVGQDKWNLKIKQGNQKETEIWVSWLKETKNRSKKLETLLEFGKNMADEELLS
FT                   NREKITGKLQKTYKEAWKIEPSEETQISLWFINLLEIIIFKIKMTYSQLMNKIESVSES
FT                   IEREGRKIITKVNLDGSSITKLIVNNTVTNEKISTEIFISNTFHAIKYNNTVLIGDNTL
FT                   LKFVLSIEENELNMNIVKDYNFMKGEKSDNLFIDFMMRLKKVPQPLRTSIAANYETVCL
FT                   MMADHKCSSSTLPIIDAVIELMKLDKEIGEELLSICMISDGVTCIKASTLAKMNTYAEV
FT                   NELEGLKKYVQRTNRNHDVSKESIERLRCMMRMKIITNYIKKFGVVPQMTCNSGLLEQE
FT                   LNLMASGGSYNNHIIRNTSHYKDVKLGKILQPGNEVNISSRVIDKACTKDEYDFSGNSV
FT                   KELVYYITKNDLVDLIDEIEIGKLYEENKRKDRETKCFFRKDKELSEMKKYKICRLVEK
FT                   EKELKTEGRFYGVASFKLKIYISIIMEMIKRAMKLIPGQMMTMTEDERRTVMHRMSVML
FT                   EEKDAYTLFLDYSGHNTSQRPENNLFILEEIADMYGFEENSIERKRLIQVVYLFNELEI
FT                   LYEHLFSDMVVWSKRQKGAIEGWFGPLWGIQSQLMLDDMMVSMGIEKYIGTTYSDDSCG
FT                   VFIKKNLDQEELNRMIEYIQSYSLKMGLLVKLSQTQITNGRCSMLKNHYYFDKPIDTSY
FT                   KRIMSISPNSDILWGNDSERVSVIDSAYTSSVLRADDNYIQTVIRNFRIMIEIEKDVIR
FT                   WALFYDLELDPRFINLKGSLSTLGKIYRKVIDEASEIKELREIENSMPNEDEIVTQFFL
FT                   FHINNRKFLKLTLALMYLPSTCYGHALTSMVDSFISGYSYSNVKRLSYVESLFNEKKDK
FT                   VFIYSLVRLSENAISYVAEPFPMTGGRYDTKTILKDELKQLLKHKVQNNELXEMLNSFS
FT                   EDKENLFKAVLVYTFEKCFSHRIASKFYECSIFNYINELYAKINNSTTMSYLVGKKKMN
FT                   KLWNKAWKVNHKIDYKFQGNIIEEIKNDPSYFGLVMGRDKIDKKVMQNNELKYFSIKFL
FT                   NIEELPIIGKLSSDNLTGQLRCIIKPMRVYSKIKGLRLPGPVRTAINITKFDRDLEIEG
FT                   MFQNKLIFMAYELVRYVKWMIFDMEKYNKQDNTQAIKSLRKLTDITIGTFSDAKIADIE
FT                   EVVVCPKGGRYFHRALSGGFNPKTGDLSSNMLSSRIEVTGLDRLTNETGGVDNNINIQL
FT                   VITALKVQLSLIGYKNNETVSIGLDSDVKYFAKDVTFTLDHIKSELELSCDLGLSHRFG
FT                   SMTLEKLNEKRTLYHNFSHFVSVNEDIAGKFIDHKTILPSSKIEEISSFQSLNKYMQDM
FT                   EILVPTQIPTNIMKELVPNLESYGSVDRYLEEFYKFYKGLNIIGNESFTKAVIRSIINK
FT                   ELFERKNIEGKDWLKEIEMTGFSYGYRKSLLKIFIVSCCMVFKVEEPTGNTLKITIFEE
FT                   KTKINCLNNIKRIKNSEAHLHINDKRISDLINMAFPLVGYQLKDVFVAVREIMDEHNGK
FT                   IIDGTKVIQYFNVENISYVSKLEEENCGRISYSNIALKPSDLSDEKQFIASIKAFEMIA
FT                   TLNCKPQHVSSPTKSDVYPSAKALLDYLINSNIIKADSKIADLFAGRGDFHLLMNNLGL
FT                   DHTSISRNDGYNLINRIPGMKEIKANIDITYGENYGQYLDHDIFILDISHFTGDPNNII
FT                   RMIDDILSVGKKAIIRWNSIAPVCTKLLYNFVIKRHHKIDILIPTIESPGYIYLLFNGE
FT                   FYTSKEILDGENSRKEKKTYNENIITSNMILELNRIRKTSILNCSGIKVSDHTQELISD
FT                   DKLISILEENENKSYISNDIEMRIEEGEKLEELLMILNPTKELLNLENTITQEIKVEED
FT                   DRGARSLKYFKRLVSETKSVLGIKRIKLNKNFLKWMIRENKINLEDGKILIIEGIKNGP
FT                   CNEVKKTINMIIEDKNTSKINQEAWICVKAGIDQFISVEGENAECDMKVILMMIQGSTE
FT                   YKSRFFSYDRILRLAHMASDAIKTGTMAESILVLSGLRSGVLSSLKKNKGKALRYDCLN
FT                   IKLIMNRMLVLSEERNIIIQASNLRLSEIVKDILLFRKIGQGAKRIKKSIRGKFKKGDR
FT                   NNKPIISWFDEDEELELECTELLEQREIEEEILRLREFDRLEDYLESQGINELFSAITD
FT                   ELSKEGVRMEITEEHLAQGIDNQANILSEGFRNFLGVQDDEVEKNRNMTIEEMRKIVED
FT                   NEECEYLSDEE"
FT   CDS             complement(7527. .8147)
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q80H97"
FT                   /product="24 kDa protein"
FT                   /protein_id="AAO34633.1"
FT                   /translation="MAEYIEVRVENLHKWGLELNTEQIETLSKKLKNIVNEDCIMKTSR
FT                   IIGMWIFMPDIVQESLKDSPLVTKKAWIIPHERTYKTIYGKDGIQMAVTQNEEDLFKDP
FT                   EFFMISRCDSVMLTKNNKTIIINKELMNCDISQDMLFNMLSCQEQEITEELLKKLKIII
FT                   SSNPKERLENKIDEVFWNSTRILNWIQHNDNSGSNSSDNSFRE"
XX
SQ   Sequence 8184 BP; 2129 A; 1597 C; 1048 G; 3408 T; 2 other;

AY224663  Length: 8184  October 21, 2003 08:51  Type: N  Check: 8662  ..
       1  ggtatcctaa attagggatt atcgtcttgt cggacaattg atagcgcaat
      51  gctttgaggg tgttcaacaa ctgcatttac aatccttcta ttctagggtt
     101  cttattgttt aacataaatt atcgttgtac aaataattat tgtagttatt
     151  tttctaatct taccttttat tcttcatcag acagatattc acattcttca
     201  ttgtcttcaa ctatttttct catttcttct atggtcatat tcctattttt
     251  ttccacttca tcatcttgta ctccaaggaa gttcctgaat ccctcagata
     301  atatgtttgc ttgattatcg attccttgag ctaagtgttc ttctgttatt
     351  tccatcctaa ctccctcttt ggatagctca tctgtgattg cagaaaataa
     401  ctcatttata ccttgactct ctaagtaatc ttctagtcta tcaaactctc
     451  ttaacctcaa gatttcctct tcgatttctc tttgttctaa taattcagta
     501  cattctaatt ctaattcttc atcttcatca aaccatgaaa taataggctt
     551  attgttccta tctcctttct tgaattttcc ccttatcgat tttttgattc
     601  tcttagcccc ttgtcctatc tttctaaata gtaagatgtc tttcacaatt
     651  tctgataatc ttagattgct tgcttgtatg attatatttc tttcttcgga
     701  aagcaccagc atcctgttca taatcaactt tatgttcaag caatcatatc
     751  tcaatgcttt tcctttgttc tttttcaatg atgagagcac acctgacctc
     801  agaccactaa gcactaatat gctttcagcc attgtccctg tttttatagc
     851  atctgatgcc atatgtgcta atctcagtat tctatcatat gagaaaaatc
     901  ttgatttgta ttctgtgctt ccttgtatca tcatcagtat caccttcatg
     951  tcacactctg cattctctcc ttctactgat atgaattgat ctattcctgc
    1001  tttcacgcag atccatgctt cttgatttat tttactagta tttttgtctt
    1051  caattatcat atttattgtc tttttcacct cattgcatgg gccatttttt
    1101  ataccttcta ttatgagtat ctttccatcc tctaagttta ttttattttc
    1151  tcttatcatc catttcagaa agttcttatt caattttatc ctctttatcc
    1201  ctaacaccga ttttgtctca gacaccaatc ttttaaaata ttttaggctt
    1251  cttgctcctc tatcatcttc ttctactttt atttcttgtg ttattgtgtt
    1301  ttccaggttc agcaactctt tggttggatt caatatcata agtaattctt
    1351  ccaatttttc tccttcctca atcctcatct ctatatcatt tgatatgtaa
    1401  gacttatttt cattttcttc taagatactt attaatttat catcactgat
    1451  taactcttgt gtgtgatctg atactttaat tcctgagcaa tttaatattg
    1501  atgtctttct tatcctgttt agctctaaaa tcatatttga ggttatgatg
    1551  ttttcattat atgttttctt ttcttttcta ctattttctc catctaagat
    1601  ttcctttgac gtataaaatt ctccattaaa taataaatat atgtaaccag
    1651  gtgactctat agttggtatc aaaatatcta ttttatgatg cctttttatt
    1701  acaaaattat acaatagttt tgtacacaca ggagcaatcg aattccatct
    1751  tattatagct ttctttccca cagatagtat gtcatctatc attcttatta
    1801  tgttgtttgg atcgccggtg aagtgtgata tgtctaaaat aaaaatatca
    1851  tgatctaagt actgtccata attttcacca taagtaatat ctatgttggc
    1901  tttaatctct ttcattccag gtatcctgtt tatcagattg taaccatcgt
    1951  tcctggaaat ggatgtgtgg tctagcccca agttgttcat aagaagatga
    2001  aagtctcctc ttccggcgaa taaatcagca attttgctgt ctgctttgat
    2051  gatattgctg tttatcaagt aatctaaaag tgcttttgcg ctaggataaa
    2101  catcagattt tgttggtgag gaaacatgtt gtggcttaca attaagcgtt
    2151  gctatcattt cgaaagcttt tattgatgct atgaattgtt tttcatcgct
    2201  caaatcgctt ggctttaggg caatattaga ataagagatt cttccgcaat
    2251  tttcttcttc caacttgctc acgtacgata tgttttcaac attaaaatat
    2301  tgtatcactt ttgttccatc aatgattttt ccattgtgct catccattat
    2351  ttctctcaca gctacaaaga catctttcaa ttggtatcct actagtggaa
    2401  acgccatatt tattaggtca cttattcttt tatcattaat gtggagatgc
    2451  gcctctgaat tttttatcct cttaatattg ttcaaacaat ttatttttgt
    2501  cttctcttcg aatatggtta tttttagagt gttacctgta ggttcctcaa
    2551  ccttgaacac catacagcat gacactataa atatcttaag tagtgatttt
    2601  ctgtaaccat atgagaaccc tgtcatttct atttctttca accagtcttt
    2651  tccttctatg ttttttcttt caaataattc tttattaatt attgacctta
    2701  tcactgcttt agtgaagctt tcatttccaa ttatgttcag ccctttgtaa
    2751  aatttataaa attcttctaa gtatctatcc acggacccat aagattctag
    2801  atttggaact aattctttca ttatgtttgt aggtatctgt gttggtacca
    2851  atatttccat gtcctgcata tacttattca aagattggaa tgaacttatt
    2901  tcttctatct ttgaggatgg taatatggtt ttgtgatcta tgaacttacc
    2951  cgcaatatcc tcatttactg atacaaagtg tgaaaaattg tgatacaatg
    3001  ttcttttttc attcaatttc tcaagagtca ttgaaccaaa cctatgtgat
    3051  aatcctaagt cgcaacttaa ctcaagttca ctcttaatat ggtcaagagt
    3101  gaatgtcacg tcttttgcaa agtatttgac atcactgtct aatcctattg
    3151  acactgtttc gttgttttta tatcctatca atgataattg tacttttaat
    3201  gctgttatca ctaattgtat atttatattg ttatctactc cccctgtttc
    3251  attggtgagc ctatcaagtc ctgtcacttc tattcttgaa cttaacatat
    3301  ttgatgataa atcccctgtt ttaggattaa agcctccaga taatgctcta
    3351  tgaaaatatc gtcctccttt tgggcacacc accacttctt ctatgtcagc
    3401  aattttcgca tcggagaatg tcccgattgt gatatcagtc aatttcctaa
    3451  gggatttaat tgcctgagtg ttgtcttgct tattgtattt ttccatgtca
    3501  aatatcatcc atttcacata tctcacaagt tcgtatgcca taaaaatcag
    3551  cttgttctgg aacattccct ctatttctaa atctctgtca aactttgtta
    3601  tgtttattgc tgtcctaaca ggtccaggca atctcaatcc ttttatttta
    3651  gagtaaactc tcatcggttt gatgatgcac cttaattgtc ctgtcaagtt
    3701  gtctgaactt aatttaccta ttataggcag ttcctctatg tttaggaact
    3751  ttatgctgaa atatttgagt tcattgttct gcattacttt tttatcaatt
    3801  ttatctctcc ccatcaccaa tccaaagtaa ctaggatcat tttttatctc
    3851  ttctataatg tttccttgga atttataatc aattttatgg tttactttcc
    3901  atgctttatt ccatagttta ttcattttct tttttccaac taggtaactc
    3951  attgttgtcg aattgtttat ctttgcgtaa agttcattta tgtaattaaa
    4001  tattgaacac tcataaaatt ttgatgctat tctatgtgaa aagcattttt
    4051  caaatgtata gaccaataca gctttgaaca gattttcttt atcttctgaa
    4101  aatgagttta acatttctyt taactcatta ttttgaactt tgtgtttcaa
    4151  tagctgtttc aactcatctt tcagaatagt cttagtgtca tatcttccac
    4201  ctgtcattgg gaatggctca gctacataac ttattgcatt ttcacttaat
    4251  ctcactaaag aataaataaa tactttatct tttttctcat tgaataggct
    4301  ctctacataa gagagtcttt tcacatttga gtatgaataa cctgagatga
    4351  agctatcaac catagatgtt aatgcatggc catagcatgt tgaaggtaaa
    4401  tacattaatg ctaatgttaa ttttaaaaac ttcctattat ttatgtgaaa
    4451  taaaaagaac tgtgttacta tttcatcctc atttggcatt gaattttcta
    4501  tttctcttaa ttcttttatt tcagaagcct catctatgac ttttctgtaa
    4551  atcttcccta acgtgcttaa agaacctttc agatttatga atcttggatc
    4601  caattccaag tcataaaata aagcccatcg aatcacatct ttttctatct
    4651  caatcatgat tctgaaattt cttatcacag tttggatgta attatcgtcc
    4701  gccctcaaca cactggacgt gtatgcacta tctatcactg acactctttc
    4751  tgagtcattt ccccataata tgtcagaatt tggtgatatt gacattattc
    4801  tcttatatga tgtgtctatc ggtttgtcaa aataataatg atttttcaac
    4851  attgagcatc ttccatttgt tatttgtgtt tgtgaaagtt tgactaatag
    4901  tcccattttt aatgagtagc tttgtatata ctctatcatt ctgttcagtt
    4951  cttcctggtc taggttcttc tttatgaata ctccacatga gtcatcagaa
    5001  tacgttgttc ctatgtattt ttctattccc attgaaacca tcatgtcatc
    5051  tagcatgagt tgggactgta ttccccataa tggtccaaac catccttcta
    5101  tggctccttt ttgcctttta gaccacacta ccatgtctga gaacaaatgt
    5151  tcatacaata tctctaactc attaaacaaa taaacaactt ggataagtct
    5201  tttcctttct atagaattct cttcgaatcc atacatatcg gctatttctt
    5251  ccaagatgaa caaattgttt tcaggtcttt gagatgtatt gtgaccagaa
    5301  taatctaaga ataaggtata tgcatctttt tcttctaaca taacggacat
    5351  tctatgcata actgtccttc tttcatcttc tgtcattgtc atcatttgac
    5401  caggtattaa tttcatagct ctttttatca tttccattat aatggaaatg
    5451  taaatcttta gcttgaaact ggcaacacca taaaatcttc cttctgtttt
    5501  taactctttt tctttttcta ctaatctaca tattttatac tttttcatct
    5551  cagataattc cttatctttt ctaaaaaaac actttgtctc acgatctttt
    5601  ctcttgttct cctcatacaa ttttcctatt tctatttcat ctatcaaatc
    5651  caccagatca ttctttgtta tatagtaaac aagttccttt accgaatttc
    5701  cagagaaatc atattcatct ttggtgcaag ctttgtctat tactctcgaa
    5751  gatatgttaa cttcatttcc cggttgcaat atctttccta atttcacgtc
    5801  cttgtagtgc gaagtgttcc gaatgatatg attgttgtaa cttccccctg
    5851  aggccattaa attgagttct tgctccaata accctgaatt acatgtcatt
    5901  tgtggtacca caccaaactt ttttatatag ttagttataa ttttcattct
    5951  catcatgcac ctcaaacgtt ctatcgattc ttttgataca tcatgatttc
    6001  tgtttgttct ttgtacgtat ttttttaggc cttctaattc gttcacctca
    6051  gcatakgtgt tcattttagc taatgttgac gctttgatgc aagtcactcc
    6101  gtcagatatc atacatattg acaatagttc ttctcctatt tctttgtcca
    6151  gtttcattaa ctctatcaca gcatcaatta tgggaagggt agatgatgaa
    6201  catttatggt cagccatcat gaggcaaaca gtttcataat tcgctgcaat
    6251  tgatgttctc aatggctggg gtaccttttt taatctcatc atgaaatcaa
    6301  taaacaaatt gtcactcttt tctcctttca tgaaattgta atctttaaca
    6351  atgttcatat ttaattcatt ctcttcaatt gacaatacaa attttaaaag
    6401  tgtattgtct cctattagca ctgtattgtt gtatttaatt gcgtgaaacg
    6451  tattgctgat gaatatttct gtgcttattt tttcattcgt aaccgtgtta
    6501  ttcacaatca acttagttat gctacttcca tccaaattga cttttgttat
    6551  aatttttctt ccttccctct ctatcgactc gctcacactc tcaattttat
    6601  tcatcaattg agaatatgtc atttttattt taaaaattat tatctccaat
    6651  aagtttatga accataatga tatttgagtc tcttctgatg gctctatttt
    6701  ccaggcctct ttgtatgtct tttgtaattt tcctgttatt ttttctctgt
    6751  tggacaataa ctcttcatct gccatgtttt ttccgaattc taacaaagtt
    6801  tcaagcttct tactcctatt ttttgtctct tttaaccatg atacccaaat
    6851  ctccgtttct ttctggtttc cttgttttat ttttaagttc catttatctt
    6901  gacccacaaa ttcccttaat ctaaaaaggt caatttttga tctaactcca
    6951  aacttttcag ggtaatcctc tctgtatatg aagtcttcta ttgtttcttt
    7001  tggtattgtt ttgtatggtg aatctaacct ggatatcagt gatggtctat
    7051  cgacatatgt tccaacatag gttaagtggt cccaattaat ccaatacttc
    7101  aacatgctag tgtaatttat ttcttctttt tttggttcta aacttttctc
    7151  atgatcctga gcaatgcgta acatgatata ttcttccttt tttcctgata
    7201  atatgctata tgctgaagga taatctttca tttcttttat taggtttgtg
    7251  tattcttctg tgtaactttt ccttgattct aaagctttct ttatttcttc
    7301  ttcttttttt gccaactcta ttgctgtatc ttctgacgct attatgtcac
    7351  ttgttacgat ctctatctca tcttctaagg tgatcttgct tgatgctttt
    7401  tcatcgctcc actccatctc tgcgttacct cgtttttatt caattaccct
    7451  tttgtttcac acttttaatt ttaattttaa ttaaaacgat gataaccgat
    7501  atcgattagg tttaaagatt ttaatttcac tcgcggaaag aattgtctga
    7551  tgaatttgat ccagaattat cattgtgctg tatccaattt agtattcttg
    7601  ttgaattcca aaacacttca tctattttgt tttctagtct ttctttgggg
    7651  ttcgaactta ttattatctt caatttcttt aacagctctt ctgttatttc
    7701  ctgttcctgg caagataaca tgttaaacaa catgtcttga gatatgtcac
    7751  aattcatcaa ttctttgttt attatgattg tcttattgtt ttttgtcagc
    7801  atcacactat cacatctaga tatcataaag aattcagggt ctttgaatag
    7851  atcttcttca ttctgcgtca ctgccatctg gattccgtct ttcccgtata
    7901  ttgtcttata tgttctttca tgtggaatta tccatgcttt ttttgtcact
    7951  aggggagaat cttttaaaga ttcttggaca atgtcaggca tgaatatcca
    8001  cattccgatt attctggatg ttttcatgat gcaatcctca ttgactatgt
    8051  tttttaattt tttagacagt gtctcaatct gttctgtgtt caattccaac
    8101  ccccatttgt gtaaattttc aactcttact tctatatatt cagccatatt
    8151  tcagaatgat cacttttcct tgaaaaaaag tatc