!!NA_SEQUENCE 1.0
ID   GFLRNA3    standard; RNA; VRL; 1114 BP.
XX
AC   D00442;
XX
SV   D00442.1
XX
DT   05-MAR-1991 (Rel. 27, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 5)
XX
DE   Grapevine fanleaf virus satellite RNA (RNA3), complete cds.
XX
KW   .
XX
OS   Grapevine fanleaf virus satellite RNA
OC   Viruses; Satellites; Satellite Nucleic Acids.
XX
RN   [1]
RP   1-1114
RX   MEDLINE; 89279276.
RX   PUBMED; 2471799.
RA   Fuchs M., Pinck M., Serghini M.A., Ravelonandro M., Walter B., Pinck L.;
RT   "The nucleotide sequence of satellite RNA in grapevine fanleaf virus,
RT   strain F13";
RL   J. Gen. Virol. 70:955-962(1989).
XX
DR   SWISS-PROT; P17768; VP3_GFLV.
XX
CC   The satellite RNA has a polyadenylated 3' end, and probably a
CC   protein (VPg) linked to the 5' terminus, and produces 39K protein
CC   in a wheatgerm translation system.  Furthermore there is the weaker
CC   upper band.  It may be readthrough product of 39K protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1114
FT                   /db_xref="taxon:141860"
FT                   /mol_type="genomic RNA"
FT                   /note="5' end of satellite RNA."
FT                   /note="satellite RNA (RNA3)"
FT                   /organism="Grapevine fanleaf virus satellite RNA"
FT                   /clone="pA4 and pA5"
FT   misc_feature    3. .10
FT                   /note="consensus sequence at the 5' end of nepovirus RNAs"
FT   CDS             15. .1040
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:P17768"
FT                   /note="39K product, P3"
FT                   /protein_id="BAA00343.1"
FT                   /translation="MDSYVTVDPSFHSPRISLEILVPTKYAKLFTLKQLSRMLALSCKH
FT                   RARQAANPVSKRTSRDRNGSKTMGQGPSAVAPQVSKGHNQQVDGGVCLAPVKSKRAVRR
FT                   EKRRTAAKKATNKAKTETKLVKKGGSSIHAPKAPKRTSYLSSLLSSPSGAKAKMGALSK
FT                   PPQTKNAPDANEGGFTLTAITPAECRAEARRRFHPITGSSRGPYGFCTRSREGCGVCAD
FT                   CVEKKAHLDFNRSFDTIGTSRVIRVDSMMEEVAEDLASPSVLEPSGFWAPAEKQAPSGE
FT                   GHSRRRCDVVTLARVTPVLRMLRKVDPTLVDNRLLWEAAFRTVFPQRKCVYPHGCFCDR
FT                   G"
FT   variation       720
FT                   /note="t in clone pA5; c in clone pA4"
XX
SQ   Sequence 1114 BP; 246 A; 295 C; 313 G; 260 T; 0 other;

  D00442  Length: 1114  July 15, 2003 09:01  Type: N  Check: 2791  ..
       1  tatgaaaaat ttctatggac tcttacgtta ccgtggatcc atcttttcac
      51  tctcccagaa tctcacttga gattctggtc cctaccaagt atgcgaagct
     101  gtttaccctt aagcagctct ctcgcatgct tgcattgtcg tgtaagcacc
     151  gtgcacggca agccgctaac ccggtaagca aacggacctc ccgagaccga
     201  aatgggagta aaacaatggg tcagggtcct tctgctgtgg ccccgcaagt
     251  gtcgaaggga cacaatcagc aagtagatgg aggggtttgt ctagccccgg
     301  tgaagtcaaa gcgtgcggta cggcgtgaaa agcgccgtac tgccgctaag
     351  aaggccacta ataaggccaa gaccgagacc aaactcgtta aaaagggtgg
     401  gtctagtatc cacgccccaa aggcaccgaa gcggacgtcg tatttgtcta
     451  gtctgctttc gagtccttct ggggcgaaag ccaaaatggg ggctctgagc
     501  aagccccccc aaacaaaaaa tgctcccgac gccaacgagg gtggtttcac
     551  cctcactgct atcacaccgg ctgagtgccg ggcggaagct aggcgcagat
     601  tccaccccat cacaggatcc tctcgtggtc cttatgggtt ctgcacccgc
     651  tcccgtgagg gttgtggcgt gtgtgccgat tgtgtggaaa agaaggcaca
     701  cctggacttc aaccggagtt ttgacactat tggcacttcg cgtgtcattc
     751  gtgtcgactc gatgatggaa gaagtggccg aagacttggc cagccctagt
     801  gtcctagaac cctctgggtt ctgggctcct gctgaaaagc aggctccttc
     851  tggagagggg cattcccgta gaaggtgcga cgtggtgaca ctcgcacgcg
     901  taactccggt tctccggatg ttgcgtaagg tcgatcccac tcttgtggac
     951  aaccgacttt tatgggaggc cgcgtttagg acggtctttc ctcagcgcaa
    1001  gtgcgtgtat ccccacggtt gcttctgtga ccgtgggtag ggaagattgc
    1051  agcgggacat cgtttgttta tagtctggcg taagctggga ttttggttgc
    1101  tcattagcca actc