ID   D00915; SV 1; linear; genomic RNA; STD; VRL; 7342 BP.
XX
AC   D00915;
XX
DT   02-JUL-1992 (Rel. 32, Created)
DT   22-DEC-2007 (Rel. 94, Last updated, Version 7)
XX
DE   Grapevine fanleaf virus gene for 253K polyprotein, complete cds.
XX
KW   .
XX
OS   Grapevine fanleaf virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales;
OC   Comoviridae; Nepovirus; Subgroup A.
XX
RN   [1]
RP   1-7342
RA   Pinck L.;
RT   ;
RL   Submitted (22-MAR-1991) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Lothaire Pinck Institut de Biologie, Moleculaire des Plantes du
RL   CNRS (IBMP); 12 rue du General Zimmer, 67084 STRASBOURG Cedex, France
XX
RN   [2]
RX   PUBMED; 1655953.
RA   Ritzenthaler C., Viry M., Pinck M., Fuchs M., Pinck L.;
RT   "Complete nucleotide sequence and genetic organization of grapevine fanleaf
RT   nepovirus RNA1";
RL   J. Gen. Virol. 72:2357-2365(1991).
XX
RN   [3]
RA   Margis R., Pinck L.;
RT   "Effects of site-directed mutagenesis on the presumed catalytic triad and
RT   substrate-binding pocket of grapevine fanleaf nepovirus 24-kDa proteinase";
RL   Virology 190:884-888(1992).
XX
RN   [4]
RA   Margis R., Viry M., Pinck M., Bardonnet N., Pinck L.;
RT   "Differential proteolytic activities of precursor and mature forms of the
RT   24K proteinase of grapevine fanleaf nepovirus";
RL   Virology 200:79-86(1994).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7342
FT                   /organism="Grapevine fanleaf virus"
FT                   /segment="1"
FT                   /strain="F13"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12274"
FT   CDS             243. .7097
FT                   /codon_start=1
FT                   /product="253K polyprotein"
FT                   /db_xref="GOA:P29149"
FT                   /db_xref="InterPro:IPR000605"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR004004"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR014759"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29149"
FT                   /protein_id="BAA00761.1"
FT                   /translation="MWQVPEGSQCCCTGKSFSNAEAKELRYVCSCWMSTRLVKAEAPPQ
FT                   QSRKSGIAPTPLKSKGTIQVSLPKATGVKPSIHKSKGASVAPAPLLKQRCEVVVQYGPP
FT                   ADIELVYPPLVREEEKSSNIVVLPPTQKVEVRVPVCCAPKWMVAIPKPPVKLAPKASKL
FT                   RFPKGAVAYNGVNFIDTKGKVVLSEGAKRILRGIRVAAKQRLRAARRSAACKKVRAKRA
FT                   LAEFEAIVQSERLDQLKTGFQVVLPAPKMSCSLKEAAPSTTSVVVVKKRKLPRLPKILP
FT                   EQDFSCLEGFDWGEKSHPVEVDIEDDWILVEKPVLKRQAVQTAQGRATEALTRFAATSG
FT                   FSLGAHQKVEDFASSGEAEYLMAGEFADLCLLSLVYNDAPTLSATIEELRDSKDFLEAI
FT                   ELLKLELAEIPTDSTTCAPFKQWASAAKQMAKGVGTMVGDFTRAAGAAVVISFDMAVEF
FT                   LQDKALKFCKRIFDVTMAPYLQHLASAHSILKKIWEKLSEWMESLKSKASLALEVMRQH
FT                   AIFALGAMVIGGVVVLVEKVLIAAKIIPNCGIILGAFLTLFFASLGLTALECTAEEIFR
FT                   MHACCKSAIYSMYSVAEPTMADEGESHTMGATQGLDNAIQALTRVGQSMISFKLGSFSY
FT                   YAKIAQGFDQLARGKRAIGELTSWLIDLVGSIYSQVSGQESTFFDELSTIVCLDVRAWL
FT                   LKSKRVRLQVETMAIGDRITLDTIAKLLEEGHKILVTAAGVPRKTSADFTMCIKEEVSK
FT                   LEEVHARTACAGINEGMRAFPFWVYIFGASQSGKTTIANSIIIPALLEEMNLPKSSVYS
FT                   RPKTGGFWSGYARQACVKVDDFYAIEQTPSLASSMIDVVNSEPYPLDMAYIHEKGMSMD
FT                   SPLVVTTANTAVPPTNSQVVDLPSFYNRRAAVLEVRRKDGSFFTPRAYDSCIEVRFMHN
FT                   KCPYVDSAGVPQGPAVNTPMDEGWITPSEAVAVLKNLLGEHILAEEAKLLEYRERIGND
FT                   HPIYNAAKEFIGNMHYPGQWLTAEQKSTYGIKDDGFSFLAVDGKIYKYNVLGKLNPCES
FT                   EPPHPNVIPWLEKKTLEIVHWDVHKHIATGPRNALVACFLQGLVQGQSKVESVERMGKD
FT                   SSPEQQNFFKRLSLSERIYLRLCQIRIDNIQKEELAGSGRGPMAILRECLMKSKQVVVE
FT                   NYSLLLTLVAILLLISAAYTLLSTVVALAGCSSFAGGMVAVTAVNNASIPCSEPRLEER
FT                   YSPRNRFVSRISKIRGEGPSKGQGEHEELVTELYYYCDGVKKLISTCWFKGRSLLMTRH
FT                   QALAVPIGNEIEVIYADGTTKKLVWPGRQEDGNCKGFVEFPENELVVFEHPHLLTLPIK
FT                   YEKYFVDDADRQISPNVAVKCCVARLEDGIPQFHFWSKYATARSEVHTLKDEGGGNVYQ
FT                   NKIRRYIVYAHEAKKYDCGALAVAVIQGIPKVIAMLVSGNRGVTYSSVIPNYSSSFIRG
FT                   EVPYVPEDGLVSRGYRKVGYLHASDAPHVPSKTSFMKVPDELCFPYPDPKQPAILSAED
FT                   ERLKGTIHEGYTPLRDGMKKFAEPMYLLEEKLLDEVAGDMVQTWYDPGEFLEDISLDQA
FT                   INGDMDEEYFDPLVMDTSEGYPDVLDRKPGEKGKARFFVGEPGNRAFVAGCNPEKAYYQ
FT                   LEEDSKTKIPSLVSIETPKDERLKRSKIDTPGTRLFSVLPLAYNLLLRVKFLSFSRLLM
FT                   KKRGHLPCQVGINPYSREWTDLYHRLGELSDVGYNCDYKAFDGLITEQILSTIADMINA
FT                   GYRDPVGNRQRKNLLLAICGRLSICGNQVYATEAGIPSGCALTVVLNSIFKELLMRYCF
FT                   KKIVPPVYKECFDRCVVLITYGDDNVFTVAQSVMQYFTGDALKMQMAKLGVTITDGKDK
FT                   SLSTIPARPLLELEFLKRGFVRSSGGMINAPLEKLSIMSSLVYIRSDGSDMLQKLLDNV
FT                   NTALVELYLHGDRTYFESVRAFYFEKLPPGAYKELTTWFQAESFHECQKSGESGYKPQG
FT                   LIEISHGAAFASFTQQAGTELEKHDICPGLSIAGTKYIATENEIVLSLSSVLPGDRNVF
FT                   KLDLPCGDGIGRLPSKCSILNLRKPGLVMRLCKRAQDEKKTLVIRDERPYIGAWAVACI
FT                   CGESFGFGQQSVLALYANLLGPNQRNGLASYFSDFESPIHIKKVHAKTNSYEGGEALKE
FT                   IFTFCETIFYEATEMDTRKVMLQNQPDVYPSISLVGGVCFPNEGGEPGAMYSETDVTMA
FT                   REVQGVYVSEACVKCCRRCVGVATRVVTDTQLFGNNLLKTHLKALRKIQNHTCLRK"
FT   mat_peptide     3894. .3965
FT                   /product="VPg"
FT   mat_peptide     3966. .4622
FT                   /product="protease"
FT   mat_peptide     4623. .5627
FT                   /product="RNA polymerase"
XX
SQ   Sequence 7342 BP; 1977 A; 1409 C; 1864 G; 2092 T; 0 other;

d00915 Length: 7342  22-DEC-2007  Type: N  Check: 6382  ..
       1  atgaaaattt cccacaagtt cttacgttac cgtgattgca atcttttcct
      51  gtgaagagtt taagaaactc aagattgaaa tcctttgcga agagtttaag
     101  aaactcaccc ctcgaagcgt ttaagaaacg cattgtttta ttgtgcttgt
     151  tgcttatttt gtgcagttta cttttaatct acatatttta ctgtgttatt
     201  tatttaagtt taattttgta gttgtaaaag ttgtttgcca ctatgtggca
     251  ggtgcctgag ggctcccagt gctgctgcac tgggaagtcc ttttcaaacg
     301  cggaggctaa ggaactccgc tacgtgtgct catgttggat gagcacacgt
     351  cttgttaagg ctgaggctcc tcctcagcaa tcaaggaaga gtgggatagc
     401  gcccactccc ctaaaatcca aagggaccat tcaggtctca ctcccaaagg
     451  ctactggggt caaacccagt atccataaat ccaaaggagc ttctgtggct
     501  cctgcacctt tgcttaagca aaggtgtgaa gtagtcgttc aatatgggcc
     551  tcctgccgat attgaattgg tctacccgcc tcttgtgcgg gaggaggaga
     601  agtcctccaa tatagtggtt ctgccaccta cccaaaaggt ggaagtaagg
     651  gtgccagttt gctgtgcacc caagtggatg gtggctatcc ctaagccacc
     701  ggtgaagcta gcccctaaag ctagcaagct acggtttcct aaaggagccg
     751  tagcttacaa tggtgtcaat tttattgaca ctaaggggaa agtcgtccta
     801  tctgagggcg caaagaggat ccttaggggg atccgcgttg ctgcaaagca
     851  acgtcttcgt gctgcgcgca ggtctgctgc gtgcaagaag gtgagggcca
     901  agcgtgctct tgccgagttt gaggcaatcg ttcaaagtga acgattggac
     951  cagttaaaga ctgggttcca agtggtgctt ccagcaccaa agatgagctg
    1001  cagcttaaaa gaagctgctc cttctaccac ttctgtggtg gtagttaaga
    1051  agaggaagct gccaaggctt cctaaaattc tgcctgagca ggacttctcc
    1101  tgcttagagg gctttgactg gggggagaaa tcccacccag ttgaggtaga
    1151  catcgaggat gattggatcc tcgtggaaaa acctgtcctt aagagacagg
    1201  ctgtgcaaac tgcacagggc agggcaaccg aggccttaac tcggtttgca
    1251  gctaccagtg gcttctcact gggcgcccac caaaaggtgg aagatttcgc
    1301  ttcgtctggt gaagcggaat atttgatggc aggagagttt gcagacctct
    1351  gcttgctatc tttggtgtat aatgatgcac cgacgttgtc tgcgactatt
    1401  gaggaactca gggatagcaa agattttcta gaggctatcg aactcctcaa
    1451  gttggaatta gctgaaattc caacagactc cactacatgt gccccattta
    1501  aacaatgggc ttctgctgcc aagcagatgg ctaaaggggt tggcactatg
    1551  gttggggatt ttactagagc tgctggagcc gctgtcgtta tctcttttga
    1601  tatggcagtg gaatttctgc aagataaagc gttaaagttc tgtaaaagaa
    1651  tctttgacgt aacaatggct ccatatctcc agcatcttgc cagtgcacat
    1701  tccatcctta agaagatttg ggaaaaattg tcagaatgga tggaaagcct
    1751  caagagtaaa gctagtttag cacttgaagt aatgcggcaa cacgccattt
    1801  tcgctttagg tgctatggtt ataggaggtg tagtagtgtt ggtagaaaaa
    1851  gtgcttattg cagccaaaat tatccctaat tgtgggatta ttctgggtgc
    1901  ctttttgaca cttttctttg ctagcctggg gttaacagcc ctggagtgca
    1951  ctgcagagga aatcttcaga atgcatgcgt gttgtaaaag tgctatttac
    2001  tccatgtatt ctgttgcaga gcctactatg gctgatgagg gagaatctca
    2051  cactatgggg gcgactcagg gacttgataa tgcaattcag gccctgactc
    2101  gagtaggaca gagtatgata agcttcaaac tggggagctt ttcatattat
    2151  gcaaagatag cccaggggtt tgaccaactt gcaaggggta agcgagcaat
    2201  aggtgaactt actagttggc tcatcgatct tgttggaagt atttactccc
    2251  aggtttctgg acaggaaagt actttttttg acgagctttc tacaattgtt
    2301  tgcctagatg tgagagcatg gctactgaaa agtaagcgtg ttcggttgca
    2351  agtggaaaca atggccatag gcgatagaat aaccttggat actattgcca
    2401  aattgttaga agaaggccac aagatactgg tcactgcggc aggtgttcca
    2451  aggaaaacgt ctgctgattt tacaatgtgc atcaaggaag aagtgtctaa
    2501  gttggaagaa gtgcatgcca gaacggcatg tgcgggaatc aatgagggta
    2551  tgcgagcttt tcctttttgg gtgtacattt ttggtgcttc acagtctggg
    2601  aagacaacaa tagcaaattc aatcattatt ccagctttgc tggaagaaat
    2651  gaatcttccc aagagctcag tttattccag gcccaagact ggtgggtttt
    2701  ggagtggtta tgctaggcaa gcatgtgtga aagttgacga tttttatgca
    2751  attgagcaga cccctagcct ggcgagttct atgattgatg tggtgaattc
    2801  agaaccttat cccctcgaca tggcttacat tcacgagaag ggaatgtcaa
    2851  tggattctcc attagttgta accactgcaa ataccgccgt gcctcctacc
    2901  aattctcagg tggtggactt gccgtcattt tataacagga gggcggcggt
    2951  actggaagta cgcaggaagg atgggagttt ctttacaccg cgggcgtatg
    3001  attcatgcat tgaagttcgc ttcatgcata ataagtgtcc gtatgttgat
    3051  tctgctgggg tgcctcaggg ccctgcagta aacactccca tggatgaagg
    3101  atggatcact ccaagtgagg ctgttgcagt tctcaaaaat ctcttgggtg
    3151  aacacatttt ggctgaggaa gcaaagctgc tggaatacag agagcggatt
    3201  ggtaatgacc atcccatata taacgcagca aaggaattca taggcaacat
    3251  gcactatcct gggcagtggc tgactgctga acagaagagt acctatggaa
    3301  tcaaggatga tggattctct ttccttgcgg ttgatggaaa gatatacaag
    3351  tacaatgtac tgggtaagtt gaatccatgt gagtctgaac caccacatcc
    3401  caatgtgatt ccatggttgg aaaagaaaac attagaaatt gtacattggg
    3451  atgtgcataa acatattgcc actggtcccc gcaatgcact ggttgcatgc
    3501  tttttgcagg gcttggtcca aggacaaagc aaagtagaga gtgtggaacg
    3551  tatggggaaa gatagttctc cggaacaaca gaattttttt aaacgcttga
    3601  gtttatccga gagaatttat ctgaggctgt gccaaatccg cattgataat
    3651  atccagaaag aagagctggc gggttctggt agagggccca tggcaatatt
    3701  gagagagtgt ctgatgaaga gtaagcaggt agtggtggaa aactactcat
    3751  tgctattgac attggtggct attctcttgc ttatcagtgc tgcttacacg
    3801  ctactctcaa cagtggtggc tctggcgggt tgctctagtt ttgctggtgg
    3851  tatggttgca gtgacggctg tcaacaatgc ttctataccg tgttcagagc
    3901  ctcgcttgga ggaaagatat tcccctagaa atcgttttgt ctcgcgaatt
    3951  tctaaaatta ggggtgaggg accttccaaa ggacaaggtg agcatgagga
    4001  attggttact gagctctatt actattgtga tggagttaag aagctaattt
    4051  ccacgtgttg gtttaaggga aggtcactct tgatgacgag acatcaagcc
    4101  ctggccgttc cgatcggcaa tgaaattgaa gtaatatacg ctgacggaac
    4151  aacaaaaaag ttagtttggc caggcaggca ggaggatggc aattgcaaag
    4201  gcttcgtcga attccctgaa aatgagttag ttgtctttga gcatccacac
    4251  ttattgacac tgcccattaa gtatgagaag tactttgttg atgatgccga
    4301  tagacagatt tcccccaacg ttgcggttaa gtgttgcgtt gcgcgcttag
    4351  aagatggaat tccccaattc cacttttgga gcaaatatgc aacagcccgc
    4401  agtgaagttc atacgctgaa agatgagggc gggggaaatg tctaccagaa
    4451  caagataagg cgctatattg tttatgcgca tgaagcaaag aagtatgatt
    4501  gtggagcctt ggctgtggct gtgatccaag gaatcccaaa agtcatcgca
    4551  atgcttgttt ctgggaatag aggtgtgacc tactcttctg tgattccaaa
    4601  ctacagttct tcttttatta ggggagaagt gccatatgta ccagaagatg
    4651  ggttagtgtc gaggggatat aggaaagtgg gttatttgca cgcatcggat
    4701  gcgccacatg tgccttctaa gacttccttc atgaaggtac cagatgaatt
    4751  gtgctttcca tatcctgatc ctaagcagcc cgccatcctt agcgcagagg
    4801  atgaacgcct taagggaacg atccatgaag gatacactcc gttaagggat
    4851  ggcatgaaga agtttgctga gccaatgtat ctgctagagg aaaaactact
    4901  cgatgaagtt gcaggtgaca tggttcagac gtggtatgac ccgggtgaat
    4951  tccttgaaga tatttcttta gatcaagcta tcaatgggga catggatgag
    5001  gaatattttg accccctagt gatggacacg tctgaaggat atcccgatgt
    5051  tttagatcgt aaacctgggg aaaagggaaa ggcgagattc tttgttgggg
    5101  aaccaggaaa tagagccttt gtagctggtt gtaatcctga aaaggcttat
    5151  taccaactag aagaggactc taaaaccaag ataccttcct tggttagtat
    5201  agaaacccca aaagacgaga gattaaaaag aagtaaaatc gatactcctg
    5251  gtacgagatt attttctgtg ctgcccttgg catataatct cttgttgaga
    5301  gtaaaatttt tgtctttttc ccgcctactg atgaagaaga gaggccacct
    5351  gccttgtcaa gtgggcatca atccttatag tcgcgaatgg accgatttgt
    5401  atcaccgctt aggtgaactc tctgatgtcg gatacaattg tgattataag
    5451  gcttttgatg gcctaattac ggagcaaatt ttgagtacga tcgccgatat
    5501  gatcaatgct ggatatcgtg accctgtcgg caataggcag aggaaaaatt
    5551  tgctcctagc aatatgtgga cgcctctcta tctgtggaaa tcaagtgtat
    5601  gccactgaag caggcatacc ttcaggctgt gctctcacag tagtactcaa
    5651  ttccattttt aaagaactac tgatgagata ttgcttcaag aaaatagttc
    5701  cccctgtgta caaggaatgt tttgacagat gtgtcgtgct cattacctat
    5751  ggtgatgata atgtcttcac tgtggcacaa tctgtcatgc agtattttac
    5801  tggcgatgct ctgaaaatgc aaatggcaaa gcttggggta actattactg
    5851  atgggaaaga taagtctctt tccactattc cagcccgtcc actgctggaa
    5901  ttagagtttt tgaaacgtgg atttgttaga agctctgggg gtatgataaa
    5951  tgcgcctttg gaaaaattat caataatgag ttctttggtc tacatcagaa
    6001  gtgatggctc agacatgttg cagaaactat tggacaatgt taatactgca
    6051  cttgtcgagc tttatctaca tggtgataga acttattttg aatcagtcag
    6101  agctttttac ttcgagaaac tccctcctgg cgcttataag gagttgacaa
    6151  cgtggtttca agcagaatca tttcatgagt gtcagaagag tggagagagt
    6201  ggttataagc cacaagggct cattgagatt agtcatggag cagcttttgc
    6251  cagttttact caacaagctg gtacagagtt ggaaaagcat gacatttgcc
    6301  ctggcttatc gattgcagga actaagtaca ttgctactga gaatgagatt
    6351  gttttgtctc ttagttccgt cctacccggg gatagaaatg ttttcaagtt
    6401  ggatctgcct tgtggagacg ggatagggcg tttgccttcc aaatgcagta
    6451  tcttaaactt gagaaaaccg ggcttggtta tgagattgtg caagcgtgcc
    6501  caagatgaaa agaagacctt agttattcgt gacgaaaggc catacattgg
    6551  tgcatgggca gttgcttgca tatgtggaga gagttttggc ttcgggcaac
    6601  agagcgttct tgcgctttat gccaacttgt tgggaccaaa tcagaggaat
    6651  ggcttagcca gttatttttc tgattttgaa agtcccattc atatcaagaa
    6701  agtccatgcc aaaacaaact cttatgaggg gggtgaagct ttaaaggaaa
    6751  ttttcacttt ttgtgagact attttctatg aagccaccga aatggatact
    6801  aggaaagtga tgttgcaaaa tcaaccagac gtctatccta gtataagtct
    6851  tgttgggggg gtttgtttcc caaatgaggg aggagagcct ggagccatgt
    6901  actcggaaac agatgttacg atggctagag aggttcaagg agtctatgta
    6951  agtgaagcgt gcgtgaaatg ttgcaggcgt tgtgtaggag tagcaaccag
    7001  ggttgtgact gatacgcaac tttttggcaa caatctttta aagactcatc
    7051  ttaaggcttt gaggaaaatt cagaatcata catgccttag gaaataagcc
    7101  ttccaattct tggtactggg ataaccaagt ttaaataacc cagtttcttt
    7151  tgcctttcat gctcttttag gcaattgaat attagagcat ttgtgttatt
    7201  gtttgtttta acttgttttc tgctttagtg tgttttcttt catgctttta
    7251  gtggcgacag tgtgttgttt gtcctttgga accacttgcc ttgttggacg
    7301  caaaaagatt ttcttttttc tttttactgt tatgcaaatt tt