!!NA_SEQUENCE 1.0
ID   TOBMTRCP   standard; genomic RNA; VRL; 2196 BP.
XX
AC   J04347;
XX
SV   J04347.1
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 9)
XX
DE   Tobacco Rattle virus coat protein, 16K protein, and 13K protein genes,
DE   complete cds.
XX
KW   13 kDa protein; 16 kDa protein; coat protein.
XX
OS   Pepper ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-2196
RX   MEDLINE; 89299469.
RX   PUBMED; 2741345.
RA   Angenent G.C., Posthumus E., Brederode F.T.M., Bol J.F.;
RT   "Genome structure of tobacco rattle virus strain PLB: Further evidence on
RT   the occurence of RNA recombination among tobra viruses";
RL   Virology 171(1):271-274(1989).
XX
CC   Draft entry and computer-readable copy of sequence [1] kindly
CC   provided by Angenent,G.C. 04-APR-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2196
FT                   /db_xref="taxon:31750"
FT                   /mol_type="genomic RNA"
FT                   /organism="Pepper ringspot virus"
FT   mRNA            474. .2196
FT                   /note="viral mRNA (alt.)"
FT   CDS             570. .1199
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProt/Swiss-Prot:P69471"
FT                   /note="coat protein"
FT                   /protein_id="AAA47078.1"
FT                   /translation="MGDMYDEQFDKAGGPADLMDDSWVESTAWKDLLKKLHSVKFALQS
FT                   GRDEITGLLTTLSRQCPYSPYEQFPERKVYFLLDSRANNALGVIQNASAFKRRADEKNA
FT                   VAGVTNIPANPNTTVTTNQGSTTTTKANTSSTLEEDLYTYYKFDDASTTFHKSLTSLEN
FT                   MQLKSYYRRNFEKNFGVKFGSASTPASGGSGATPPPASGGAVRPNP"
FT   mRNA            1497. .2196
FT                   /note="viral mRNA (alt.)"
FT   CDS             1518. .1943
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR007968"
FT                   /db_xref="UniProt/Swiss-Prot:P33777"
FT                   /note="16K protein"
FT                   /protein_id="AAA47079.1"
FT                   /translation="MTCVLKGCVNEGTVLGHETCSIGHANKLRKQVADMVGVTRRCAEN
FT                   NCGWFVCVIVNDFTFDVYNCCGRSHLEKCRKRIEARNREIWKQIERIRAERSFATVKKS
FT                   RNSKPSKKKFKERKEFGTPKRFLRDDVPLGIDQLFAF"
FT   CDS             1546. .1899
FT                   /codon_start=1
FT                   /db_xref="UniProt/Swiss-Prot:P33776"
FT                   /note="13K protein"
FT                   /protein_id="AAA47080.1"
FT                   /translation="MKALFLVTRRVVSVMLTSCESKLPTWLVSHVGVRKIIVDGLSVLL
FT                   LTILLLMCIIVVAVVTLKSVVNVLKRGIEKSGNRLNEFELKDRLLRLKSPEIRNPLRRN
FT                   SKREKSLGHQKDF"
XX
SQ   Sequence 2196 BP; 637 A; 376 C; 517 G; 666 T; 0 other;

   J04347  Length: 2196  May 10, 2005 10:09  Type: N  Check: 8607  ..
       1  ataaaacatt gcacctttgg ctgtcgcccc tggctggggt atgtctttga
      51  acgcagtaga atgtgctaat tgacaagttg gagaacgcgg tagaacgtac
     101  ttatccgaca gcctttatcc ctcttcctga cgaggttttt gtcagtgtat
     151  catgttgttt tgaactatcc aacttagtac cggaatggga aagtgattgg
     201  tgtgcttatc ttcgatatga tgctttgaat tttgcatagt aggaagttag
     251  aaaagaaact cttgtcttct caaacaagta aaacctgaga cgtgttaact
     301  acgaaagtgt ccattcaaaa tatcatgaac gaacgtagtt tgtttgtggt
     351  taccaaaaac gataagaaca cctttaaggt tttctttacg caagtgttcg
     401  ccagaacact ggggttttgt cagtttcttt agagaaaact gactaagttt
     451  ctaatgttat cattagagat ggcataaata aactgtttgt gtctgctgat
     501  aagatcattt ttactttgac agttagcttt gctgaactac tggttactga
     551  atcacttacg ctaactaaca tgggtgacat gtacgatgag caattcgata
     601  aggcgggagg gcctgcagat ttgatggatg actcatgggt tgagtctaca
     651  gcttggaaag atcttttaaa gaaactgcat agcgtaaaat ttgcgctaca
     701  gtctggtaga gatgagatca ccggtttgct gaccactctc agtagacagt
     751  gtccttattc gccgtacgaa cagtttcctg aaagaaaggt ttactttttg
     801  ttagactcac gtgctaataa cgctctcggt gttattcaga acgcttctgc
     851  cttcaagagg agagccgatg agaagaatgc tgtagctggt gttacaaata
     901  taccagccaa tccaaatacc acggtcacta caaatcaagg tagtactact
     951  actacgaagg cgaacacaag ctcgactttg gaggaggatc tgtatactta
    1001  ttacaaattc gatgacgcct cgacaacatt tcataaatct ctgacgtcgt
    1051  tggaaaatat gcaactgaag agttattatc gaagaaattt tgagaagaac
    1101  tttggtgtca aatttggtag cgcgtcgact ccggcctcgg ggggaagtgg
    1151  tgcaacacca cctcctgcga gtgggggtgc tgtgcgtcct aatccttgat
    1201  gtcgtcaaat caaaccttta agggaccttg tgaaattcaa ggggcgggtg
    1251  ttgccagaaa tcaccgatac tactagttgt atcaaaacaa aactaatcac
    1301  aacttgcatt ttactagtgc atgttgaatt cctgtggaag tcaggaggtg
    1351  gatgttacca taaacattaa tgtcgcatga agacgattga ggcgaagtat
    1401  gatggtcctt acagaccggc tactactaga ccaaaatcat tattgtcaag
    1451  tgaagatgtt aagggagcgt ctaaaaagaa aaactcgtct taatgcataa
    1501  agaaatttat tgtcactatg acgtgtgtac tcaagggttg tgtgaatgaa
    1551  ggcactgttc ttggtcacga gacgtgtagt atcggtcatg ctaacaagtt
    1601  gcgaaagcaa gttgccgaca tggttggtgt cacacgtagg tgtgcggaaa
    1651  ataattgtgg atggtttgtc tgtgttattg ttaacgattt tacttttgat
    1701  gtgtataatt gttgtggccg tagtcacctt gaaaagtgtc gtaaacgtat
    1751  tgaagcgagg aatcgagaaa tctggaaaca gattgaacga attcgagctg
    1801  aaagatcgtt tgctacggtt aaaaagtccc gaaattcgaa accctctaag
    1851  aagaaattca aagagagaaa agagtttggg acaccaaaaa gatttttaag
    1901  agatgatgtt ccgttaggaa ttgatcaatt gtttgctttt tgattttatt
    1951  ttatattgtt atctgtttct gtgtatagac tgtttgagat tggtgtttgg
    2001  ccgactcatt gtcttaccat agggggacgg actttgtttg tgttgttatt
    2051  ttatttgtat tttattaaaa ttctcaatga tctgaaagct tcgcggctaa
    2101  gagattattg gggggtgagt aagtactttt aaagtgatga tggttacaaa
    2151  ggcaaaaggg gtaaaacccc tcgcctacgt aagcgttatt acgccc