!!NA_SEQUENCE 1.0
ID   TBSCPP     standard; genomic RNA; VRL; 4776 BP.
XX
AC   M21958; M31019;
XX
SV   M21958.1
XX
DT   26-APR-1990 (Rel. 23, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Tomato bushy stunt virus complete genome.
XX
KW   capsid protein; coat protein; complete genome; p19 protein; p22 gene;
KW   p33 protein; p41 protein; p92 protein.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   2621-4776
RX   MEDLINE; 89163266.
RX   PUBMED; 2922927.
RA   Hillman B.I., Hearne P., Rochon D., Morris T.J.;
RT   "Organization of tomato bushy stunt virus genome: characterization of the
RT   coat protein gene and the 3' terminus";
RL   Virology 169(1):42-50(1989).
XX
RN   [2]
RP   1-4776
RX   MEDLINE; 90281577.
RX   PUBMED; 2353450.
RA   Hearne P.Q., Knorr D.A., Hillman B.I., Morris T.J.;
RT   "The complete genome structure and synthesis of infectious RNA from clones
RT   of tomato bushy stunt virus";
RL   Virology 177(1):141-151(1990).
XX
CC   Draft entry and computer-readable sequence [1] kindly submitted by
CC   P.Q.Hearne, 16-DEC-1988.  Draft entry and computer-readable
CC   sequence for [2] kindly submitted by D.Knorr, 21-DEC-1989. The 5'
CC   terminal nucleotide was not determined.  However, in the infectious
CC   constructs, two 5' terminal 'g' residues are added, one of which is
CC   removed during subsequent replication in host plants.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4776
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /organism="Tomato bushy stunt virus"
FT                   /strain="cherry"
FT   CDS             166. .2622
FT                   /codon_start=1
FT                   /db_xref="GOA:Q88485"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q88485"
FT                   /note="read-through of p33"
FT                   /transl_except=(pos:1054. .1056,aa:OTHER)
FT                   /product="p92 protein"
FT                   /protein_id="AAB02535.1"
FT                   /translation="METIKRMIWPKKEIFVGDFATGVNRTVPVNIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRTGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARTPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYSGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFRAK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQYEHSFYRAMYPGNKLLGKLLEWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLIVER
FT                   RNLKQIQRTLPEYFLNLGYTMKVEQPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVETFYSRFKLYDVPRKHQRIDTVTN
FT                   VHKWRGSGGSYVVTPESRASFWAAFGLTGDEQLALEDRLERWEMDLFGEEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             166. .1056
FT                   /codon_start=1
FT                   /db_xref="GOA:P15962"
FT                   /db_xref="UniProt/Swiss-Prot:P15962"
FT                   /product="p33 protein"
FT                   /protein_id="AAB02534.1"
FT                   /translation="METIKRMIWPKKEIFVGDFATGVNRTVPVNIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   mRNA            2621. .4776
FT                   /note="2.2kb subgenomic mRNA"
FT   CDS             2652. .3818
FT                   /codon_start=1
FT                   /db_xref="GOA:P11689"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/Swiss-Prot:P11689"
FT                   /product="p41 capsid protein"
FT                   /protein_id="AAB02536.1"
FT                   /translation="MAMVKRNNNTGMIPVSTKQLLALGAAAGATALQGFVKNNGMAIVE
FT                   GAVDLTKRAYKAVRRRGGKKQQMINHVGGTGGAIMAPVAVTRQLVGSKPKFTGRTSGSV
FT                   TVTHREYLSQVNNSTGFQVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYTFNSVVLH
FT                   YVPLCSTTEVGRVAIYFDKDSEDPEPADRVELANYSVLKETAPWAEAMLRVPTDKIKRF
FT                   CDDSSTSDHKLIDLGQLGIATYGGAGTNAVGDIFISYSVTLYFPQPTNTLLSTRRLDLA
FT                   GALVTASGPGYLLVSRTATVLTMTFRATGTFVISGTYRCLTATTLGLAGGVNVNSITVV
FT                   DNIGTDSAFFINCTVSNLPSVVTFTSTGITSATVHCVRATRQNDVSLI"
FT   mRNA            3841. .4776
FT                   /note="0.9kb subgenomic mRNA"
FT   CDS             3856. .4425
FT                   /codon_start=1
FT                   /db_xref="GOA:P11691"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/Swiss-Prot:P11691"
FT                   /product="p22 protein"
FT                   /protein_id="AAB02537.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLRPSKKKASKTDSSV"
FT   CDS             3888. .4406
FT                   /codon_start=1
FT                   /db_xref="GOA:P11690"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:P11690"
FT                   /product="p19 protein"
FT                   /protein_id="AAB02538.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESNVSRGCPEG
FT                   TETFEKESE"
XX
SQ   Sequence 4776 BP; 1257 A; 983 C; 1315 G; 1220 T; 1 other;

   M21958  Length: 4776  May 10, 2005 10:09  Type: N  Check: 4810  ..
       1  naaattctcc aggatttctc gacctagttc gtttatctgg tgacttgcgc
      51  taccgttgct ttgcgtagag aatttctctc cataattatt atctttagtt
     101  gtggggtttg aaggttgggt ctacctttcg gggggataaa ttgtaacttc
     151  caacaaacaa gcgacatgga gaccatcaag agaatgattt ggcctaagaa
     201  agagattttt gtgggtgatt tcgcaaccgg agtgaatagg acagttccgg
     251  tgaacatctt tcaattggtg tgtcgtgtgg ttctgagata catgaggaca
     301  gggaaaatag agtgtgattc tgacagcatg actaagttta tagttgaatt
     351  actcaaaact gattgtgctg ccaaatggga atggttcatg aagagacggc
     401  agaggggtga ttacattgtc cctctatcta tagcctccat accaatcata
     451  ccgctgttga gttatgccac tagggtacgc gcagtctcag tcaaggcttt
     501  tggcaatgaa ctatcgttca atgtcagggt gcctagacca tctgtaccta
     551  agaaaggatt gctcctcaga ctggcggcag gtctagcgtt agctcctata
     601  tgcgcgctgg ccgtgtacgc taccctacct agggaaaaac tgtcggtatt
     651  taagctgaga actgaggcac gagcacacat ggaggatgag agagaagcga
     701  cagattgtct ggtggttgag ccggcaaggg aacttaaggg taaagatggt
     751  gaggatctcc tcactggtag tagattgact aaggtgatcg cgtccactgg
     801  gcgccctcgt cgaagacctt atgcggcaaa gatcgcacag gtggcgagag
     851  caaaggtggg ttaccttaag aacagtccag agaatagact aatctaccag
     901  agggtgatga tcgagatcat ggacaaagac tgcgtcaggt atgttgacag
     951  ggatgtcata ttgcctttgg ctattggatg ctgttttgtc tatccggatg
    1001  gagtggagga gtcggcggca ctatggggct cacaggagtc cctgggtgtc
    1051  aaatagggag gcctagtacg tctacctggg gttgtaacac agatcaatcg
    1101  agatatccca tctgatgtgt tacttcctca ggaggtgcta gaggttcgta
    1151  caggacctcc caatgctaag gaccgtaata tatttatggt tgcaggttgc
    1201  ccatcacagg cacggttctt agtacataat cactgcctga aaaaccttaa
    1251  aaggggtctt gtggagagag tcttctgcgt agagagaaac gggaagctcg
    1301  ctcgcactcc acaacctacc aaaggagcct ttggacgtct ttccccgttc
    1351  aggaaagcgg tttgtgagaa ggttggggta gcccaccgac ttgggtatga
    1401  tgggtttctg tcatactaca gcggtgcgaa actccgtact tacacacgag
    1451  ccgtggagag tctgcatatc acacctgtct ccgagaggga tagtcacttg
    1501  actaccttcg taaaagcaga gaagatatcg acgtctaagg gtgacccagc
    1551  acctcgggtg attcagcctc gaaacccgag gtacaatgtg gaacttggaa
    1601  gatatctacg gcatatggaa tccaagctga tgaaagctgt tgatggcgtg
    1651  ttcggagaga cgacatgcat caaaggatac acagctgatg aggtaggtgc
    1701  aattttccgg gctaaatggg acaggtttga taagcctgtc gccatagggc
    1751  tcgatgcatc taggtttgat caacactgtt ccgttgaagc attgcaatat
    1801  gagcatagct tctacagggc catgtaccct ggcaacaagc tcttgggcaa
    1851  gttgttggaa tggcagctcc ataataaagg taaaggttat gttccagatg
    1901  gaactataac ctatcgcaag gagggctgtc gcatgagtgg ggatataaac
    1951  acctcgttgg gcaactatct actgatgtgt gcaatggtac atgggtacat
    2001  gcgtcatctg gggattaatg agtttagtct ggcaaactgt ggggatgatt
    2051  gcgtcctaat tgtcgaacgc aggaatctta agcagataca gagaacttta
    2101  ccggagtatt tcctcaatct gggatatact atgaaggtgg agcaacctgt
    2151  atttcaactg gaagaggttg aattttgcca ggcacaccca gtacagtttc
    2201  aaggcggttg gaagatggtt cgaaacgtcc gtactgctat gagcaaggat
    2251  gtgcactgtg tcaacaatat acgcgatttg gcgacgagga gagcttggag
    2301  taatgctcaa catcatgggg gtctagcgct tagtgctggt attccagttg
    2351  tggagacgtt ttactctagg tttaagcttt atgatgtacc tcgtaaacat
    2401  caacgtattg acacggtcac aaatgtgcac aagtggcgtg gatccggtgg
    2451  gagttatgtt gtgacccctg aatctagggc tagcttttgg gctgcctttg
    2501  gactcacggg ggatgagcaa ctggctctgg aggaccgtct ggaaagatgg
    2551  gagatggatc tgtttggaga ggagggtgtt gacgctcatg agcccagcat
    2601  cctcgactcc gccgtagctt gaccaagaat acacacacgc aggatagaca
    2651  catggcaatg gtaaagagaa acaacaacac gggaatgatc ccggtgagta
    2701  caaagcaatt actggcattg ggtgcggccg ctggggccac agccttgcag
    2751  ggatttgtca agaataatgg gatggccatc gttgaggggg ctgtcgatct
    2801  gactaaaaga gcgtacaaag cagtgcggag aagaggaggt aagaaacagc
    2851  agatgattaa tcatgtaggt ggtacaggtg gtgctataat ggcgccggta
    2901  gcagtgacta gacaacttgt cggtagtaag cctaagttta ctggcaggac
    2951  gtctggctct gtcacagtta cccaccgtga gtatctgtca caagtgaata
    3001  attccacggg tttccaagtt aatgggggaa ttgtcggcaa tttgttacag
    3051  cttaacccgt tgaatggtac attgttctct tggttgccag cgatagcatc
    3101  caattttgat cagtacacat tcaacagcgt tgtgctacat tatgtgcccc
    3151  tatgttcaac tactgaggta gggagagtgg ctatttactt tgataaggac
    3201  tcagaagatc cagaacctgc tgatagagtt gagttggcga attacagcgt
    3251  gcttaaagag acagcccctt gggctgaagc gatgcttagg gtacccaccg
    3301  ataagattaa gagattttgt gatgacagtt ccacatctga tcacaaactt
    3351  atcgacttgg gtcaattggg cattgctaca tatggtggcg ctgggactaa
    3401  tgctgtgggg gatatcttta tctcgtacag tgttacgtta tatttccctc
    3451  aacctacgaa cacactcctt agtaccagaa ggctcgacct tgctggcgct
    3501  cttgtcacag catctggccc tggatacctc ctggtgtcta ggactgccac
    3551  tgtattgaca atgacattcc gtgctacagg cacgtttgtc atatccggga
    3601  cgtatcggtg cctcacggca acaacgttag gcttggctgg cggagtgaat
    3651  gtcaatagta tcacagttgt agataacata ggtacagaca gtgcgttttt
    3701  cataaattgt actgtctcta acctaccatc tgtggtgaca ttcacatcta
    3751  ccggtatcac atctgccaca gtacattgcg tgcgcgcgac acgacagaat
    3801  gatgtttctc taatttagtg tgtcctgcga ggggcctctt gaacaagacc
    3851  agttcatgga tactgaatac gaacaagtca ataaaccatg gaacgagcta
    3901  tacaaggaaa cgacgctagg gaacaagcta acagtgaacg ttgggatgga
    3951  ggatcaggag gtaccacttc tcccttcaaa cttcctgacg aaagtccgag
    4001  ttggactgag tggcggctac ataacgatga gacgaattcg aatcaagata
    4051  atccccttgg tttcaaggaa agctggggtt tcgggaaagt tgtatttaag
    4101  agatatctca gatacgacag gacggaagct tcactgcaca gagtccttgg
    4151  atcttggacg ggagattcgg ttaactatgc agcatctcga tttttcggtt
    4201  tcgaccagat cggatgtacc tatagtattc ggtttcgagg agttagtatc
    4251  accgtttctg gagggtcgcg aactcttcag catctctgtg agatggcaat
    4301  tcggtctaag caagaactgc tacagcttgc cccaatcgaa gtggaaagta
    4351  atgtatcaag aggatgccct gaaggtactg agaccttcga aaaagaaagc
    4401  gagtaagaca gactcttcag tctgagtttg tggagatgag tgtaaatctg
    4451  gcatagcata caggttactc ttgttgggtt ctggatgtta ggatgacgag
    4501  tcgactcggg ctccgcacta ggtttggtcg cctaggggat ggagatatgg
    4551  aaagggtctc gtgtggtatc agtcggtcga aagacgcgct tccaacatgg
    4601  gcctatggtc ggataagtct tagcaatacc agccagcatg aattggattc
    4651  ctgtttacga aagttaggtg tcacttgtgg aagcggaccc agacacggtt
    4701  gatctcaccc ttcggggggc tatagagatc gctggaagca ctaccggaca
    4751  accggaacat tgcagaaatg cagccc