!!NA_SEQUENCE 1.0
ID   GF11768    standard; RNA; VRL; 1515 BP.
XX
AC   U11768;
XX
SV   U11768.1
XX
DT   11-OCT-1994 (Rel. 41, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Grapevine fanleaf virus coat protein gene, partial cds.
XX
KW   .
XX
OS   grapevine fanleaf virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Nepovirus.
XX
RN   [1]
RP   1-1515
RX   MEDLINE; 95374332.
RA   Brandt S., Ibl M., Himmler G.;
RT   "Coat protein gene sequence of an Austrian isolate of grapevine fanleaf
RT   virus";
RL   Arch. Virol. 140(1):157-164(1995).
XX
RN   [2]
RP   1-1515
RA   Himmler G.;
RT   ;
RL   Submitted (05-JUL-1994) to the EMBL/GenBank/DDBJ databases.
RL   Gottfried Himmler, University of Agriculture, Institute of Applied
RL   Microbiology, Nussdorfer Laende 11, Wien, A-1190, Austria
XX
DR   SPTREMBL; Q67623; Q67623.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1515
FT                   /chromosome="RNA2"
FT                   /db_xref="taxon:12274"
FT                   /organism="grapevine fanleaf virus"
FT                   /specific_host="Vitis vinifera ssp. French Colombard"
FT   CDS             <1. .1515
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q67623"
FT                   /product="coat protein"
FT                   /protein_id="AAA80464.1"
FT                   /translation="GLAGRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGL
FT                   VMPIFKIIVRLPANAFTGLTWVMSFDAYNRITSRITASADPVYTLSVPHWLIHHKLGTF
FT                   SCEVDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQAVVELYTELEEATSFL
FT                   GKPTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALKSAGLTLGQVPMVGTTKVYNLNSTL
FT                   VSCVLGMGGTIRGKVHICAPIFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSFEV
FT                   KIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETARLPIVVQIEEIVRPDFSL
FT                   PSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDYTSNTCRVSMGENPFAAMIACHGLHSGV
FT                   LDLKFQWSLNTEFGKSSGSVIITKLVGDKATGLDGPSQVFAIQKLEGATELLIGNFAGA
FT                   NPNTHISLYSRWMAIKLDQAKSIKVLRVLCKPRPGFSFYGRTSFPV"
XX
SQ   Sequence 1515 BP; 398 A; 284 C; 376 G; 457 T; 0 other;

U11768  Length: 1515  December 21, 2001 15:57  Type: N  Check: 6966  ..
       1  ggattagctg gtagaggagt gatttatatc cctaaggatt gccaggcaaa
      51  tagatatttg ggcaccctga atatacgtga catgatctca gattttaagg
     101  gtgttcagta tgagaagtgg ataaccgcgg gattagtcat gcctattttt
     151  aagataattg tcaggctacc tgcgaatgcc tttactggat tgacttgggt
     201  gatgagtttt gatgcttata atcggataac tagcagaatc actgctagtg
     251  cagatcctgt gtataccctg tcggtcccac attggcttat ccatcacaag
     301  ttgggcacgt tttcatgtga agtggactat ggagagttgt gtggtcatgc
     351  tatgtggttc aagtccacga catttgaatc tccacggcta catttcacat
     401  gtctaacggg caacaacaaa gagttggcgg cagactggca agctgtcgta
     451  gaactatata ccgaattgga agaggccact tcttttcttg ggaaaccaac
     501  tttggttttt gacccagggg tgttcaatgg taaattccaa tttttaactt
     551  gccctcccat attctttgat ttaacagccg tcacggctct caagagtgct
     601  gggctgacat tgggacaagt cccaatggtt ggcaccacca aggtttataa
     651  tttaaacagt actcttgtga gttgtgtttt gggtatgggg ggtactatta
     701  gaggaaaagt acacatttgt gcaccaatct tctatagtat tgttttgtgg
     751  gttgttagcg agtggaacgg gaccactatg gattggaatg aactttttaa
     801  gtatcccggg gtgtatgtgg aagaggatgg aagttttgaa gttaaaattc
     851  gctctccata tcaccgaacg cctgctagat tgcttgctgg tcaaagtcag
     901  agagacatga gctctctaaa tttttatgca atagcaggac ccatcgctcc
     951  atcgggtgag accgcacgac ttcctatcgt tgtacagatt gaggaaattg
    1001  tgcgtccaga cttctctcta ccgagttttg aagatgatta ttttgtgtgg
    1051  gtggattttt ctgaatttac ccttgataaa gaagaaatcg aaattggatc
    1101  tcgtttcttt gattacactt caaatacttg tagggtgtcc atgggggaaa
    1151  acccatttgc tgcaatgatt gcctgtcatg gattgcatag cggtgtttta
    1201  gacctcaaat tccaatggag tttaaacacc gaatttggta agagcagcgg
    1251  gagcgttatt atcacgaaac tagtgggtga taaagccacg ggtttggatg
    1301  ggccttcaca ggtctttgcc atacagaaac tagagggagc tacggaattg
    1351  ttgattggga attttgcagg agcaaaccca aatactcata tctccctcta
    1401  tagtcgatgg atggcaatta agctagacca agcaaagagc attaaagtgc
    1451  tccgtgtttt gtgcaagccg cgtccaggct tcagttttta tggaagaact
    1501  agtttcccag tctag