!!NA_SEQUENCE 1.0
ID   LI15440    standard; genomic RNA; VRL; 8118 BP.
XX
AC   U15440;
XX
SV   U15440.1
XX
DT   17-FEB-1995 (Rel. 42, Created)
DT   19-JUN-2004 (Rel. 80, Last updated, Version 4)
XX
DE   Lettuce infectious yellows virus RNA 1 methyltransferase and RNA-dependent
DE   RNA polymerase genes, complete cds.
XX
KW   .
XX
OS   Lettuce infectious yellows virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Crinivirus.
XX
RN   [1]
RP   1-8118
RA   Klaassen V.A.;
RT   ;
RL   Submitted (03-OCT-1994) to the EMBL/GenBank/DDBJ databases.
RL   Vicki A. Klaassen, Plant Pathology, University of California at Davis, 570
RL   Hutchison Hall, Davis, CA 95616, USA
XX
RN   [2]
RP   1-8118
RX   MEDLINE; 21820275.
RX   PUBMED; 11831736.
RA   Klaassen V.A., Boeshore M.L., Koonin E.V., Tian T., Falk B.W.;
RT   "Genome structure and phylogenetic analysis of lettuce infectious yellows
RT   virus, a whitefly-transmitted, bipartite closterovirus";
RL   Virology 208(1):99-110(1995).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8118
FT                   /db_xref="taxon:31713"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Lettuce infectious yellows virus"
FT                   /isolate="92"
FT                   /lab_host="Nicotiana clevelandii"
FT                   /segment="RNA 1"
FT   CDS             98. .5719
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83044"
FT                   /db_xref="UniProt/TrEMBL:Q83044"
FT                   /note="helicase"
FT                   /product="methyltransferase"
FT                   /protein_id="AAA61797.1"
FT                   /translation="MALEVESAFSLSYLLKENKQTSNNLFSLIQVPYTKMTHAKGKKTH
FT                   LLRCILGSPFETLTKSSIRRSLKNLREVCNLPYCNFKKIPKNISYKYQNPFLKLYEINN
FT                   NFINCKVGATGNTNSTYDWRNLSTIGNGWSVTSYHNDSVSRLHVSMVNNIPNSNTKKLS
FT                   WWVTRVRSKNPWKRPYKVIYQRDFRDDGIKPYVSEFILYAPKNRADLEMQSILLSSVEC
FT                   FQDIKYALNYWTNLKFKEICNSALKRFTQTNIIITPVKPRVVSVNKAREVSSSVEVKLQ
FT                   RYEREGEVFVVSKAGKEDTRVLNDDNAIRNLFNATLNGGKYKLHPEAKSATGKRFKYYK
FT                   DGFCWLDVFADANRRIPEWVKPHCLLTGSVLMSCGLWDFAKRKMVSVSHGLLHYDRKLE
FT                   RSSARAGVRDFVGASNEAVQREDFRDLDLRVEEFAERVLETANLRSDNRLIDNILTRAS
FT                   DYINKKSKESKELDINVCLSMDEKKMITNLFPDIQMSFNQKSYSNHGVFNAMRACENFY
FT                   FSRKFKNSDYIDAGGDVVSTLRSKNHNVHICSPRLDLKDAARHIQRATVIDGLKGYGET
FT                   ISFCTNKTEDCAVNRDIIIAVEVYDMTLRDMAKAMLSHGSRKFEFSCIIPPEIFTKECN
FT                   VELYEGRLKVTRIGDNVEYYYGSNGETFSHSCQTLKDILSVQVFQFGGRVFKKTLEHSR
FT                   GQLHFFSICICEKIEPGSVKLKTYYQRSELDKVTLRIPVKDSFGVVTHYIIKEDREFVS
FT                   SMIEYVANTGIKIDDKMVEWTYSQYRAKKTVTIKSGKVTQKETRIRKELIPGFIAIIMS
FT                   EGIRAREKTHYLAKMLYTSHYKPSIVNIIFRLIMHFLGGTKRFIYESLVDCLKFLTNSD
FT                   YIDTIVNTESRIEDLDKWFVFEQNVTITTDAEDQPSILEQSVKTFLSKYSEDVYERGDR
FT                   SEFELEEFSSEQDLVDQLLNSGGGSKEDEWFYSYIFSIVRTKCTLSLAWRWTNRIFNFI
FT                   TSCRAKGKDFVKYIYEIIKIIINKPWEALCHYLVQGYKTVLKIPMTCVDSVNYLKRKSL
FT                   EKILSYFSHERADDEYIFPGYDSDFSEESGDYGDENTELDSRSRCTVIKSKVEMLFRNI
FT                   KGHIEKFLQRCGIIDQYNKIYHWFKSILTDVDCFNSVLNFITHTGCDALLAVLTGHFSI
FT                   ASCALKFMTDVVIEKNLSEKHHTTTKLIAGNLTQCIYKLDFIHPIWIPIRWGVKEISKI
FT                   HIKKKLLNWRSTKEVTNESICKDLVHKSYIKYFDIKKAVWLLWFSLLIIFLHPTLGFFI
FT                   LFSIYPAIEIKRYYNNVVCFNNIKMSYPHVIDRLGGTYNFAKLKKAVREKFSENKSQGV
FT                   KISEIPAEKDEDVMPPLEEVETPKRSVGRPSSKQDDIEDECNIKEDPTESLNFSNIEAT
FT                   SNRYDTLRVGNSKLCKFLRFYPKSKCYANIQTGDLIRDSIEEFYHLERSKLDIEISKMQ
FT                   RVVEIMNDTGRMLDNVRRMIDDRSMYVTLDGVSWYRLGCKDKNPAKEDFKAIFDHNFNI
FT                   MEGNAKVKEFAVSSDEWRGMYSNERCRAIEQLFNDNNEMVRRPDVNGLKFYNKPPGAGK
FT                   TTTIAKLMSKDLKNKVKCLALSYTKVGRLELIDKLKKDGIEKPEKYVKTYDSFLMNNDN
FT                   ILEIVNLYCDEVFMMHAGHFLTLLTKIAYQNGYCYGDVNQIPFINRDPYTPAYLSREFF
FT                   RKQDLNYDTYTYRCPLDTCYLLSNLKDEMGNIIYAGGVKNVNEVYPTIRSLNLFGINVV
FT                   GEVPVEYNAKYLTFTQDEKLNLQRHIDSQGGCRNAVSTVNEAQGCTFSEVNLVRLVQFD
FT                   NPVMSDINQFVVAISRHTTTFKYFTPHSRLNDRVSNAISSLQSVSDFVLKDYHFRQCL"
FT   CDS             5808. .7238
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83045"
FT                   /db_xref="UniProt/TrEMBL:Q83045"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAA61798.1"
FT                   /translation="MDIISPGVAFYNYLHRTLIFEYSDYYLPPCEDLRITLSKSKPYHP
FT                   GAYVVSKILGKGERNRPNTWKQVIQSLSHRNFNAPIINHKLDVKRSAQILYDSVVKSLR
FT                   QDRLTEWYEPILPDLFKIGKWLDDRDGSKYRMLNRRLDFASLADKFKTLNLMVKGETKP
FT                   KMDLSTYDSYNAPANIVYYQQIVNLYFSPIFLECFARLTYCLSDKIVLYSGMNTDVLAE
FT                   LIESKLPLGLNAYHTLEIDFSKFDKSQGTCFKLYEEMMYKMFGFSPELYDRDFKYTEYF
FT                   CRAKATCGVDLELGTQRRTGSPNTWLSNTLVTLGMMLSSYDIDDIDLLLVSGDDSLIFS
FT                   RKHLPNKTQEINKNFGMEAKYIEKSSPYFCSKFIVELNGKLKVIPDPIRFFEKLSIPIR
FT                   QEDFVNGSVVKERFISFKDLMKEYDNDVAVIRIDEAVCYRYSIPVGCSYAALCYIHCCM
FT                   SNFVSFRRIYDNCEIVWI"
FT   CDS             7075. .7899
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83046"
FT                   /db_xref="UniProt/TrEMBL:Q83046"
FT                   /product="unknown"
FT                   /protein_id="AAA61799.1"
FT                   /translation="MIMMSPLYALTKQCVIDTAYRLAVPTQHCAIYTVACRILFLSVGF
FT                   MTIVKLCGFKMDTSSFIASIEKDNLMDCLISLVEMRDRLRLCNDFPILNYGVNILELLI
FT                   GKRLNKINNLKNCYVIRELITINISKEWVGKQALKVGLHCFLNLSQAESRHVKYLLSDK
FT                   ESLNKMNFSRYYVPKVVTDLYLDLIGVLYVNTGYNIDLVEKFIFDKLEFLVYDGEEGFK
FT                   SPQVEYNDICTVYNLKPIIKYNRWHTDGSIVIECGDVIGKGINKTKKKICNK"
XX
SQ   Sequence 8118 BP; 2807 A; 1296 C; 1677 G; 2338 T; 0 other;

  U15440  Length: 8118  June 22, 2004 12:21  Type: N  Check: 1497  ..
       1  ggtaaagtta tacatttacc gttggacaag gtaagattac cgacatccta
      51  atagaattgt ataacttttg ctctttcaat cttcttggag aatttcgatg
     101  gcactcgaag ttgaaagcgc tttttcttta tcttatttgc taaaagaaaa
     151  caaacaaacc tcaaataatc tcttttcgct gatacaagta ccctacacga
     201  aaatgaccca tgcgaaagga aagaagacac atcttcttag atgtatttta
     251  ggatctccgt ttgagacttt aaccaagtct agcatccgta ggtccctgaa
     301  aaacctaaga gaagtctgta atttacctta ttgcaatttt aagaaaatac
     351  caaaaaatat aagttataag tatcaaaacc ctttccttaa attatatgaa
     401  ataaacaata attttattaa ttgtaaagtg ggcgccactg gtaacacgaa
     451  ttcaacgtac gattggcgta atttgtccac tattggtaat ggttggagtg
     501  tgacgtcata tcataatgat tctgtcagta ggttacatgt aagtatggta
     551  aataacattc ctaattccaa cacgaagaag ctcagttggt gggttactcg
     601  agttaggagt aaaaatcctt ggaaacgtcc ctacaaggtt atttaccaaa
     651  gggattttcg agatgacggg attaaaccct atgtcagtga atttatttta
     701  tatgccccta aaaatagagc tgacttggaa atgcaatcca tactactgtc
     751  ttcagtagaa tgtttccagg acattaagta tgccctcaat tactggacca
     801  atttaaaatt taaagagatc tgcaatagtg cgcttaaaag gttcactcaa
     851  accaatatca ttatcacccc tgtaaaaccc agggttgtga gtgtaaacaa
     901  agcgcgagag gtttcgagta gtgtagaagt gaagttgcag agatatgagc
     951  gagagggtga agtattcgtt gtgtccaagg caggtaaaga agatacgcga
    1001  gtcttgaatg acgacaacgc cattaggaat ctgttcaacg ccactctcaa
    1051  tggtggtaaa tacaagcttc atccagaagc aaaatctgca actggaaaaa
    1101  gattcaagta ttataaagac ggattttgtt ggctcgacgt ctttgctgat
    1151  gccaacagaa gaataccaga gtgggtaaaa ccacattgtc ttctcacggg
    1201  atcagttttg atgtcgtgtg gcttgtggga ttttgcaaaa agaaagatgg
    1251  ttagtgtgtc gcacggattg cttcattatg ataggaagtt agaaagatct
    1301  tcagctagag cgggggtgag ggactttgtt ggtgcctcaa atgaagccgt
    1351  gcagagggaa gacttcagag atttagatct acgggttgaa gagttcgccg
    1401  agagagtgct agagacggcc aatttgagat ctgataacag attgatagac
    1451  aatatattga ccagggcatc agattacatt aataaaaaga gtaaagagtc
    1501  taaggagtta gatattaacg tttgtctgtc catggatgag aagaagatga
    1551  tcaccaattt atttccggac attcaaatga gttttaacca aaaatcttac
    1601  tcaaaccatg gtgtcttcaa tgcaatgagg gcttgcgaaa atttttactt
    1651  ctcaaggaag tttaaaaatt cagactatat agacgcaggt ggtgatgtgg
    1701  tatccacttt acgttctaaa aaccacaatg tccacatctg ttcgcccagg
    1751  ttagatttga aagatgctgc tagacacatc caaagggcca cagttattga
    1801  cgggctgaaa ggatatggtg aaaccatatc attctgcacc aacaaaacgg
    1851  aagactgcgc ggtgaacaga gatataatca ttgcagttga ggtttatgac
    1901  atgactttaa gggacatggc aaaagctatg ttgtctcatg gaagtaggaa
    1951  atttgagttt agttgtatca taccacctga gatattcact aaggagtgta
    2001  atgtcgaatt gtatgaaggc agactcaaag tgacgaggat tggagataat
    2051  gtagaatatt attacgggag caacggagag acgttcagtc atagttgtca
    2101  gactctaaaa gacattctat cagttcaagt cttccaattc ggcggccgtg
    2151  tgtttaagaa aaccttggag cactctagag gacaattaca cttcttctcc
    2201  atatgcattt gcgaaaaaat tgaacctggg agtgtaaaat tgaaaacgta
    2251  ttaccagaga agtgaattag ataaagtcac cctgagaata ccagttaaag
    2301  acagctttgg ggtggtaaca cattatatca taaaagaaga tagagaattt
    2351  gtcagttcta tgatagagta tgttgcgaat acaggcataa aaatagatga
    2401  taaaatggtg gaatggacct attctcagta tagggctaag aaaactgtga
    2451  ctataaaatc cggaaaggta actcaaaaag agaccaggat tagaaaagaa
    2501  ctaattccag ggtttatagc cataatcatg tcagagggga tcagggcaag
    2551  agaaaagact cattatcttg ctaaaatgtt gtacaccagt cattataaac
    2601  cttcgatagt taatatcatc tttaggttga taatgcattt tttaggtggc
    2651  actaaacgat ttatatacga gtcgttggta gactgtttaa aatttttgac
    2701  aaacagtgac tacatcgata caatagtcaa caccgagagt cgtatagaag
    2751  acttagataa gtggtttgta tttgaacaaa acgtcacgat aaccacggac
    2801  gcagaagatc aaccttctat attagaacaa agtgtgaaaa cattcttgag
    2851  caagtatagt gaagatgtat atgaaagggg tgatcgtagt gagttcgaat
    2901  tagaagaatt ttcaagcgaa caagatctgg ttgatcagtt gttgaactct
    2951  ggaggtgggt ctaaggaaga cgaatggttc tattcatata ttttttcaat
    3001  agtcagaacc aagtgcactc tgagtttagc ctggagatgg acaaatagaa
    3051  tattcaattt cataacatct tgtagagcta aggggaaaga ttttgtaaaa
    3101  tatatttatg agatcataaa aattataatc aacaaaccct gggaagcgtt
    3151  atgtcactat ttagtccagg gatataaaac tgtattaaaa atacccatga
    3201  cttgtgtcga tagtgtaaat tatttgaaga ggaagagtct agagaaaata
    3251  ctgtcgtatt tttctcatga gagagctgat gatgagtaca ttttccccgg
    3301  atatgatagt gattttagtg aagagtccgg tgattatgga gatgaaaata
    3351  ctgaattaga cagtcgcagt cgttgtacag tcattaaatc aaaagtagaa
    3401  atgttgttta gaaatatcaa aggtcacatc gaaaaattcc ttcaaagatg
    3451  tgggataata gatcaataca ataagatcta tcattggttc aaatctattt
    3501  taacagacgt agattgtttt aattcagtat taaattttat aacacacact
    3551  ggctgtgatg cattattagc agtcctcaca ggtcatttct caatagctag
    3601  ttgtgcgtta aaatttatga ccgatgtggt gattgaaaag aatctcagtg
    3651  aaaaacacca caccacaact aaattaatag caggcaattt gacgcaatgc
    3701  atatacaaat tggatttcat tcatccaatt tggatcccta ttagatgggg
    3751  cgtcaaagaa atatcaaaaa ttcacatcaa aaagaaactt ctaaattggc
    3801  gatcaaccaa agaagtcacc aacgagagta tttgtaaaga tttagtgcat
    3851  aagtcttaca tcaaatactt tgatataaag aaagcagttt ggttgttatg
    3901  gtttagtctt ctaatcatat ttttgcatcc aacgttgggt ttctttatat
    3951  tgtttagcat ttatcctgcg attgagataa agaggtacta caacaacgta
    4001  gtctgcttta acaacattaa aatgagttat ccacatgtta ttgacagatt
    4051  aggaggtacc tacaatttcg ccaaattaaa gaaagccgtt agggagaaat
    4101  tttctgagaa caagtctcaa ggggtaaaaa tttcagaaat accagcagag
    4151  aaggatgaag atgtcatgcc accactagaa gaagtagaaa cacctaagag
    4201  atcagtagga agaccttctt cgaagcaaga tgatattgaa gatgaatgta
    4251  atattaaaga agaccctact gagagtttaa atttttcaaa cattgaagcc
    4301  acatcaaaca ggtatgacac tcttcgtgta gggaacagca aattgtgcaa
    4351  attcctaaga ttttacccca agtctaaatg ttatgctaac atacagactg
    4401  gagatttgat tagggatagc atagaggaat tttaccattt agaaagaagt
    4451  aaactggata ttgagatcag taaaatgcaa agggtagtag agatcatgaa
    4501  tgatactggt cgtatgttgg ataatgtcag acgtatgatc gacgacagat
    4551  ccatgtacgt taccttagat ggagtaagct ggtataggtt aggatgtaaa
    4601  gataagaatc ccgccaaaga ggactttaaa gccattttcg accacaattt
    4651  caacatcatg gaagggaatg cgaaggttaa agaatttgct gtatcatctg
    4701  atgaatggag gggtatgtac agcaatgaaa gatgtagagc tatagaacaa
    4751  ctcttcaatg ataataatga aatggtaaga agacccgatg tgaatggtct
    4801  aaaattttat aataaaccac caggggcagg gaagacgact acaatagcca
    4851  aattaatgag caaagattta aaaaataagg tcaaatgtct ggctctatcc
    4901  tacaccaaag ttgggcgttt agagttgata gataaattga agaaagatgg
    4951  aatcgaaaag cctgagaagt acgttaagac atacgacagt ttcttgatga
    5001  acaacgacaa tatcttagaa attgtcaatt tatactgcga tgaggtcttc
    5051  atgatgcatg cgggtcactt cttaactcta ttaaccaaga tagcatacca
    5101  aaatgggtat tgttatggag atgtcaatca aattcccttc attaataggg
    5151  acccatacac acctgcttac ttatcaagag aattctttag gaaacaagat
    5201  ctaaactatg acacttatac gtacaggtgc ccattagata cctgttactt
    5251  gttgtcgaat ttaaaagatg agatgggtaa catcatttac gctggtggag
    5301  tcaaaaatgt gaatgaggtt tatccaacca tcaggtcact aaatttgttc
    5351  ggtatcaatg ttgtgggtga agtcccagtc gaatataatg ccaaatattt
    5401  aacttttaca caagatgaga agttgaacct acagaggcat atagattcgc
    5451  aaggaggttg cagaaacgcg gtcagcactg taaatgaagc gcagggatgc
    5501  actttcagtg aagtaaacct ggtcaggttg gttcaatttg ataaccctgt
    5551  tatgagcgac ataaatcaat ttgtcgtagc aatttccagg catacaacaa
    5601  cattcaaata cttcacacct cactctcgat taaatgatag agtgtccaac
    5651  gccatatcat cactacaatc tgttagtgat tttgttttga aagactatca
    5701  ttttagacag tgcctttgac gtgtatacgc tgaacttaac gcacagggac
    5751  tttaagttac cactgtgtcg accaccagct gcgagatatg agagcataat
    5801  agacctgatg gacataatat caccaggggt ggccttttac aattatttac
    5851  acaggacgtt gatttttgaa tactcagatt actacttacc tccatgtgaa
    5901  gatttgagaa taactttgag caagtccaaa ccataccacc ctggagctta
    5951  tgttgtctcg aaaattctcg ggaagggaga aagaaacaga ccgaacactt
    6001  ggaaacaagt tattcagtca ctatctcaca ggaattttaa tgcgccaatt
    6051  atcaatcaca agttagatgt taaaagaagc gcacaaatac tatatgactc
    6101  ggtggtgaaa tcgttaagac aagacaggtt gactgagtgg tatgaaccta
    6151  ttttacctga ccttttcaaa atcggtaagt ggttggatga tagagatggt
    6201  agcaaatatc gtatgttgaa ccgtagacta gactttgcca gtttagcaga
    6251  caagttcaaa actctcaacc tcatggttaa gggtgagacc aagcccaaga
    6301  tggatcttag cacatacgac agttacaatg ctccagctaa tatagtctat
    6351  taccagcaga tagtcaattt gtatttttca cccatctttt tagagtgttt
    6401  cgcaaggttg acttactgtt taagtgataa aatcgttcta tacagcggca
    6451  tgaacacaga cgttctagct gagttaattg aaagcaaact accattaggt
    6501  cttaacgcat atcacacgct tgagatagat ttcagcaaat ttgataagtc
    6551  tcaaggcaca tgcttcaaat tatatgaaga aatgatgtat aagatgtttg
    6601  gattttctcc tgagttgtac gatcgagact tcaaatacac ggagtacttc
    6651  tgtagagcga aagcaacttg tggagtggat ctcgagttag gaacacagcg
    6701  cagaactgga tctccaaaca cttggttgtc taacactcta gttactttag
    6751  gtatgatgtt atcatcttac gacattgatg atatagacct actccttgtt
    6801  agcggggatg acagtttaat tttttccagg aaacatctac cgaataaaac
    6851  ccaagagata aacaaaaact ttgggatgga ggccaagtat atagagaaat
    6901  catctccata cttctgctcc aaattcatag ttgagttaaa tggtaagttg
    6951  aaagtcatac ctgatccaat acgattcttt gaaaaattgt caattccaat
    7001  tagacaagaa gatttcgtaa acggaagcgt agtcaaagaa cggttcatat
    7051  cattcaaaga tttgatgaaa gaatatgata atgatgtcgc cgttatacgc
    7101  attgacgaag cagtgtgtta tagatacagc ataccggttg gctgttccta
    7151  cgcagcattg tgctatatac actgttgcat gtcgaatttt gtttctttcc
    7201  gtaggattta tgacaattgt gaaattgtgt ggatttaaga tggacacttc
    7251  aagttttatc gcctcgattg aaaaagacaa tttgatggat tgcttgatca
    7301  gtttagttga gatgagagat cgtcttaggt tgtgcaacga tttcccaata
    7351  ttgaattatg gagttaacat tttagaatta ctaataggca aaaggttgaa
    7401  taaaattaat aatttaaaga attgttatgt aattagagaa ctaataacaa
    7451  taaatataag taaggagtgg gttggaaagc aagctctaaa agttggctta
    7501  cattgcttct taaatctatc tcaagccgaa agcagacatg tcaagtatct
    7551  tttgagcgac aaagagtcct taaataagat gaacttctct agatactatg
    7601  tccccaaagt ggtaacagat ttgtatttag atttgattgg ggtgttatac
    7651  gtgaatacag gatacaacat agatttagta gaaaaattta ttttcgataa
    7701  attagaattt ctagtttatg atggagagga gggtttcaaa agtccacagg
    7751  ttgaatacaa tgacatatgt acggtctaca atttgaaacc aataataaaa
    7801  tacaatcgtt ggcacacaga tggttctata gttatagagt gtggtgacgt
    7851  aataggaaaa ggtattaata aaacaaagaa aaaaatttgc aataaatgat
    7901  gccaaagcgg agttcgtaaa gaacttcaaa gcaaaaaata aaaataacga
    7951  atagggtgtt ttgatagtag ttccccccta tggtctataa gtgttagtat
    8001  taataagtct tataataaaa ccaaaaatat attaatatta tatctatgtc
    8051  atgtagttaa cataaatata atgtcttcct aaaatccttg gaagactgta
    8101  tatatagaat aaaggtcg