!!NA_SEQUENCE 1.0
ID   LI15441    standard; genomic RNA; VRL; 7193 BP.
XX
AC   U15441; U05242;
XX
SV   U15441.1
XX
DT   17-FEB-1995 (Rel. 42, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Lettuce infectious yellows virus RNA 2 heat-shock protein, coat protein,
DE   and duplicated coat protein genes, complete cds.
XX
KW   .
XX
OS   Lettuce infectious yellows virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Crinivirus.
XX
RN   [1]
RP   4214-5004
RX   MEDLINE; 94292902.
RX   PUBMED; 8021583.
RA   Klaassen V.A., Boeshore M., Dolja V.V., Falk B.W.;
RT   "Partial characterization of the lettuce infectious yellows virus genomic
RT   RNAs, identification of the coat protein gene and comparison of its amino
RT   acid sequence with those of other filamentous RNA plant viruses";
RL   J. Gen. Virol. 75(Pt 7):1525-1533(1994).
XX
RN   [2]
RP   1-7193
RX   MEDLINE; 21820275.
RX   PUBMED; 11831736.
RA   Klaassen V.A., Boeshore M.L., Koonin E.V., Tian T., Falk B.W.;
RT   "Genome structure and phylogenetic analysis of lettuce infectious yellows
RT   virus, a whitefly-transmitted, bipartite closterovirus";
RL   Virology 208(1):99-110(1995).
XX
RN   [3]
RP   1-7193
RA   Klaassen V.A.;
RT   ;
RL   Submitted (03-OCT-1994) to the EMBL/GenBank/DDBJ databases.
RL   Vicki A. Klaassen, Plant Pathology, University of California at Davis, 570
RL   Hutchison Hall, Davis, CA 95616, USA
XX
CC   On Feb 1, 1995 this sequence version replaced gi:450858.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7193
FT                   /chromosome="RNA 2"
FT                   /db_xref="taxon:31713"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Lettuce infectious yellows virus"
FT                   /isolate="92"
FT                   /lab_host="Nicotiana clevelandii"
FT   CDS             693. .2357
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83047"
FT                   /db_xref="HSSP:1DKG"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="UniProt/TrEMBL:Q83047"
FT                   /product="heat-shock protein"
FT                   /protein_id="AAA61800.1"
FT                   /translation="MRDCKVGLDFGTTFSTVSTLVNNSMYVLRLGDSAYIPTCIAITPG
FT                   GEAIIGGAAEVLSGDDTPHCFFYDLKRWVGVDDNTFKFAMNKIRPKYVAELVEGEVYLT
FT                   GINKGFSIKLSVKQLIKAYIETIVRLLASSYSLRVIDLNQSVPADYKNAQRLAARSVLK
FT                   ALSFPCRRIINEPSAAAVYCVSRYPNYNYFLVYDFGGGTFDVSLIGKYKSYVTVIDTEG
FT                   DSFLGGRDIDKSIEDYLVGKYNIKKVIPATYLALIKEECNNTNKSIFTILFDDGSVQVV
FT                   EFSKSELEKCVRPFVERSIKLINDVVVRNKLTSGVIYMVGGSSLLQPVQDMVRSYASTK
FT                   GLTLVADQDMRSAVSYGCSVLHKLEDNKEIVYIDCNSHPLSDISFNCDPEPIIRKPMSI
FT                   PYTHTVKMRHDRPLKTIVNIYEGSNLFMPENDWLISSNINTTDFAKVGEEYSKVYEYDI
FT                   DGIITLKIRNEVTGKMFTLPNSFTKSDNIKPITFKLTQLSNTDDLATLTSLLGYHDKNF
FT                   ERFYGLFNVPTILIKEIDKLGGFKTLYRRLKSMNANF"
FT   CDS             2449. .3993
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q83048"
FT                   /product="unknown"
FT                   /protein_id="AAA61801.1"
FT                   /translation="MLNDRIAVTCFQTLLKKSNVKHEMEQTNNYIVNNLADINRNTFPA
FT                   LAGSVRIDFNSDYYISGGQIVVSPKDSNAYVKLLIVYLKYCYINYSAKTKYPPQSLLAV
FT                   LDYDSFKAKWVKYLDKSLTDYLDDNKTEGCSFTEQQVVEKYPQVDSLVAKILYRVCNSL
FT                   GKLLDLKDFENKNISGFEINTAQDSPTVADDNESNDFFRECVNDQRYYSSLSGSKLGKA
FT                   KLEANAYIFKILLKSASGEFDIDRLSRNPLAISKFMNLYTNHVTDSETFKSKFEALKSI
FT                   KTPFASFIKKAFGIRLNFEDSKIFYALPKERQSDVLSDDMMVESIVRDAASFTVVSDNN
FT                   YLPERVDRFVTQLLLELFPKTKASFPNKIMFGFLHYFALSTTNSKRFNDTQESTIEIEG
FT                   ETLKISLKFITSYLRNAIQSQHPDYADSNIVRLWCNKRSNLALGYFKSRNIQLYLYSKY
FT                   PRLLNYMRFDYFKGLDMGKLTDEERLSIQTLRCITEDRSEGTLATHNDLNSWILRP"
FT   CDS             4221. .4970
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83049"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q83049"
FT                   /product="coat protein"
FT                   /protein_id="AAA61802.1"
FT                   /translation="MDTDGDNDVFGSGNDTRNNDDKKKEEMKQNISDNSQIISTRDHEA
FT                   DIIGSISKEDLSKIVVRVDRHDALSANDVQSFREAMINFMRDKDPNRNQPSDKLIIAME
FT                   VGVYQMVINLGTSAKLGNANNLEFTIAYDQETRTYKVADFVNYMQSRMRNSPNVVRQYA
FT                   RAMEKTINNIRSAGIINSNGVLAAKHGVLASYRNSYSDFAVGFGNDTTDAQLTSLMLAR
FT                   KQALCKGEGGSVEHYNTMQLANLKHPC"
FT   CDS             4964. .6322
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q83050"
FT                   /product="duplicated coat protein"
FT                   /protein_id="AAA61803.1"
FT                   /translation="MLEAECDEVELTSRDVGDYLMFKTRITDNFTGDLTLNINTSNLIK
FT                   FKTCSFFICYGDDKDRYELGWTSTSTSRSIFQHYKDGKYIRDFRIQDPFPILSGSTFPV
FT                   VISKIIANRVAFRMSRRLNNVIVDKLKNNIIEFLFVVYLDVDTGKIKPNTILKNLDLSS
FT                   LFIVFSNNGNNKINLPYEIELQTKDRGIVYTKMGNPISYNLFNKFEDLLDIETKGVDKP
FT                   EDKPKPVFDDKGKQPTDTVPPVDNGKPDISKPGEKQGDIDIASKFNNIVMAKLKAQSSS
FT                   DPLTKKQCDQLMLSLIKWFEKFGITKDNARLLIFQFGISFSTSKENLNNITNNIVVEND
FT                   KGGFVKILKIDYLNKLYGSIPESHTHNLERVLLRHYAQEILILLRSKVLEWPRKLARNK
FT                   GIFEQYAYMACDFFDTAELELTEAETTALTTVKSWTMNHYKKKRQIVNSSQLE"
FT   CDS             6319. .7002
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009985"
FT                   /db_xref="UniProt/TrEMBL:Q83051"
FT                   /product="unknown"
FT                   /protein_id="AAA61804.1"
FT                   /translation="MNNFPEIFDDESTCDYDKEIDHQELSDTFWCLMDFISSKHGKSVA
FT                   DINSGMNTLINIRKSLNGSGKVVSITDSYNKTYFHSQRGLTNVDSRINIDILKIDFISI
FT                   IDDLQIIFRGLIYKDKGFLDSADLLDLDKKTTTRKFQEYFNILKIKIIEKIGMTKTFHF
FT                   NIDFRNTISPLDKQRKCSISSSHKKTNRLNDLNNYITYLNDNIVLTFRWKGVGFGGLSL
FT                   NDIKI"
XX
SQ   Sequence 7193 BP; 2544 A; 1066 C; 1367 G; 2216 T; 0 other;

   U15441  Length: 7193  May 10, 2005 10:09  Type: N  Check: 6305  ..
       1  ggtaatcaca attaccattg ggcgaaggcc aggtgtgccg taaacctaaa
      51  atatgattgt gttacggatc ctactctttt gagtagttac attatgttat
     101  gttaagatcc ttgcgtctac tcttggagaa tttcgatggc acttgagtga
     151  cgtaagttac tttttctccc taaaatccaa aatcccaaaa atccaaattt
     201  tagttaatag cagtagctgt cgcaaaccgt accctaccct aattaaaact
     251  agactatgct gcgaatacta agagcggatt aaatctgctc gcttagagaa
     301  ctctcaggtc ttctctagta taggtcatgt cgatattatt attttttctt
     351  atgtccatat tagtatggtt tatttttacc attttaaagt tattatttgt
     401  aaatactgat agtgaagtaa atataccgaa taaaagtaga ttttagaagt
     451  ttccataatt tgtaataagt attttatcaa taaaaagtag agtgataagt
     501  ctgttaataa aattttatta atgtgcaggt atattgtaaa accaaaaata
     551  aaaacagttt ctttaagtta gaataaaagt ttttctaaaa tttaaaaatt
     601  tatgtttatt ttttatttgt cgatatcaag ttcattgact gcatttgtgt
     651  taatagaata aactttattt gttgttaagt ttcaaattca aaatgagaga
     701  ttgtaaggta ggcttagatt tcggtactac ttttagtact gttagtactc
     751  ttgtgaataa cagtatgtat gtgttgagat taggtgattc ggcttacata
     801  ccaacgtgta ttgctatcac acctggaggt gaggccatca taggaggtgc
     851  tgcagaagta ctttcgggag atgatacacc tcactgcttt ttctatgatt
     901  tgaagaggtg ggttggtgtt gatgacaata cattcaaatt tgctatgaat
     951  aaaattagac ccaaatacgt agcagagttg gttgaaggtg aggtttattt
    1001  aaccggcatc aataaaggat tttctataaa gctgtctgtt aagcaattaa
    1051  taaaggctta tatagaaact attgttaggt tgttagccag ctcatattct
    1101  ttgagagtca tagatttaaa tcagtctgtt ccggccgatt ataagaatgc
    1151  tcagagatta gctgcaagat cggtgttgaa agcgttatca tttccttgtc
    1201  gtaggattat aaatgaacca tcagcagcag cagtctactg tgtgtcaagg
    1251  tatcctaatt ataactattt cttagtttat gattttggag gaggtacctt
    1301  tgatgtgtcg ctcataggta aatataagtc ttatgtcact gttatagata
    1351  ccgaaggaga ctcgttctta ggcggtagag atatagacaa gagtatagaa
    1401  gactatctag tgggcaaata taatataaag aaagtcattc cagctactta
    1451  tttagcttta ataaaagaag agtgtaataa taccaataag agtattttta
    1501  cgatactgtt tgatgacgga tctgttcaag ttgtggaatt ctctaagagt
    1551  gaattagaga aatgcgttcg tccatttgtc gaaagatcga tcaaacttat
    1601  aaatgatgtg gtggtacgaa acaagttgac atcgggagtc atttatatgg
    1651  ttggaggttc atctctatta caaccagtac aagatatggt gaggtcttac
    1701  gcgtcgacta agggattaac cttagttgca gatcaagata tgagaagcgc
    1751  agtgtcttac ggttgttcgg ttttgcataa gttggaagac aataaggaga
    1801  tcgtttatat agattgcaat tcgcatccgt tatcggacat ctcgttcaat
    1851  tgtgatccag aacccatcat acgaaaaccg atgtcaatac cttacactca
    1901  caccgttaag atgcgacatg accgtccttt aaaaacgata gtgaatatat
    1951  atgaaggatc aaatctcttc atgcctgaaa atgattggtt gatatcttcc
    2001  aatatcaata caacagattt tgctaaagta ggagaagagt atagtaaggt
    2051  ctacgaatat gatattgacg gtatcataac cctaaaaata aggaatgaag
    2101  tcactgggaa aatgttcaca ttaccgaact cgttcactaa gagtgataac
    2151  ataaaaccca tcacttttaa attaactcaa ttgtcaaaca ctgatgactt
    2201  agcgacgttg acgtctctcc taggttatca cgacaaaaac tttgagaggt
    2251  tttacgggtt atttaatgtt ccaacaatat tgatcaagga aatagacaaa
    2301  ttgggcggat ttaaaacttt gtatcgtcgt ctcaaaagta tgaatgctaa
    2351  tttttaaagg aggttgtttt cgttagagtc aatttaattt aaagtgagaa
    2401  gatcagttaa aagaaactcg acaaacataa caccaaaagt cagttaaaat
    2451  gttgaatgac agaattgctg taacatgctt tcaaacgcta ctgaaaaagt
    2501  cgaatgttaa gcatgaaatg gagcaaacca acaattatat agttaacaat
    2551  cttgctgaca taaatcgtaa tacgttccca gcactagcgg ggtcggttag
    2601  gattgatttc aactcagatt attatattag tggtgggcaa atagtagtct
    2651  ctcccaaaga cagtaatgcc tatgtgaaac ttttgatcgt ctatttgaag
    2701  tattgctaca taaattactc agcaaaaaca aaatatccac ctcagagttt
    2751  attggcagtg ttagattacg attctttcaa ggcaaaatgg gtgaaatatc
    2801  tagataaaag tttaactgat tatttagatg ataacaagac cgaaggttgt
    2851  tcatttacag aacaacaggt agtagaaaaa tatcctcaag ttgactcgtt
    2901  ggtcgcaaag atattgtatc gtgtttgcaa ttcgttaggt aaactgttgg
    2951  atttgaaaga cttcgaaaac aaaaacattt ccgggtttga gataaacaca
    3001  gctcaagatt cacctacagt agctgatgac aatgaatcaa acgatttctt
    3051  cagggaatgt gtgaacgatc aacgttatta ttcatcatta tcaggtagta
    3101  agttgggtaa ggctaaactg gaagctaacg catatatctt caaaatatta
    3151  cttaaatcag ctagtggaga atttgacata gatagactgt caagaaatcc
    3201  tttagcgatt agtaaattta tgaatttata tacaaatcat gttacagaca
    3251  gtgagacctt caaaagtaaa ttcgaagctc ttaaaagcat caaaactcca
    3301  tttgctagtt tcataaagaa agcatttggt ataagattga actttgagga
    3351  tagtaaaatc ttttacgctc tccctaaaga aagacaatca gatgtgttga
    3401  gcgatgacat gatggtagaa agtatagtga gagatgcagc aagtttcaca
    3451  gtagtttctg acaacaatta cttacctgaa agagtagata gattcgtaac
    3501  acaattacta ttagaattat ttccaaagac taaagcaagt tttccaaata
    3551  aaataatgtt tggttttctt cattattttg ctttgtctac tactaattct
    3601  aagaggttta atgatactca agagtctact atagagatag aaggtgagac
    3651  attaaagata tcattaaaat ttattacttc atatttgaga aatgccattc
    3701  aatctcaaca tccagattac gccgatagta atatagtgag actttggtgt
    3751  aataaacgta gcaacttggc tttgggttat tttaagtcta gaaacattca
    3801  attgtattta tattcaaaat atcctaggtt gcttaattat atgaggtttg
    3851  attatttcaa agggttagat atgggtaaac taactgatga agagagatta
    3901  tctatacaaa ctctccggtg catcacggaa gataggagtg agggtacatt
    3951  ggctactcac aatgatttaa attcatggat actaagacct taatagacaa
    4001  gtataacata gaaaacttca ctaattacat taacttcatc attagaaatc
    4051  atcaggcagg gaaaggtaac ttgaggtttc tagtcaattt attaaaaact
    4101  acaggagggt caaatttgaa ggagttagac atcaatccag tcgagatcga
    4151  aaacttcaac attgacattt acctagattt ccttgagttc tgtttagatt
    4201  caaaatttat attttaagat atggatacag atggagataa tgatgtgttt
    4251  ggatcgggaa acgataccag gaataatgat gataagaaga aagaggaaat
    4301  gaaacaaaac atttctgaca attctcaaat catatcaacc agggatcatg
    4351  aagctgacat cattggaagt atatcgaaag aggatttgtc caaaatcgtt
    4401  gtacgcgtcg acaggcacga tgctctgagt gctaatgatg ttcaaagttt
    4451  tagagaagct atgataaact tcatgcgaga caaagacccc aacagaaatc
    4501  aacctagtga caaattgatt attgctatgg aagttggagt ttatcaaatg
    4551  gtcataaatt tgggcacttc ggctaaattg ggtaatgcta acaatttaga
    4601  atttacgata gcttacgacc aggaaactag gacatataag gtcgcagatt
    4651  ttgtgaatta tatgcagtct agaatgagga acagtccaaa tgttgttagg
    4701  caatatgcaa gagcaatgga aaagacaatt aacaacataa ggagtgctgg
    4751  aatcataaac agcaatggag ttttggcagc gaaacatggt gtgttggcat
    4801  cttacagaaa ctcttacagc gactttgctg ttggttttgg taacgacacc
    4851  actgatgctc aactcacttc gctaatgtta gctagaaaac aagcattatg
    4901  caaaggtgaa ggtggttcag tcgagcatta caatactatg cagttagcta
    4951  accttaaaca tccatgttag aggcggaatg tgatgaagta gaactaacct
    5001  ccagagatgt cggagattat ttgatgttca aaacgagaat aaccgataat
    5051  ttcactggag atttaacctt gaatataaac acctcgaact taatcaaatt
    5101  caaaacttgt agtttcttta tatgttatgg agacgacaag gataggtatg
    5151  aattgggttg gacttcaaca tctacatcta gaagtatttt tcaacattat
    5201  aaggatggta aatacattcg agattttaga atacaagatc catttccaat
    5251  tctatcaggt tcaacatttc cagtagtgat ttctaaaata atagcgaata
    5301  gagttgcctt tcgtatgagt agaagattaa ataatgttat tgttgataag
    5351  cttaagaata acattataga gtttctattt gtagtatatt tagatgtgga
    5401  tactgggaag attaaaccaa acacaatact caaaaattta gatttgtcca
    5451  gtctttttat cgttttcagt aacaacggaa acaataaaat caatctacca
    5501  tatgagatag agctacagac taaagataga ggcattgttt acacaaaaat
    5551  gggtaatcct atatcttaca acctcttcaa taagtttgaa gatttattag
    5601  acatagaaac caaaggtgtc gataaacccg aagacaaacc caaacctgtg
    5651  tttgacgaca aaggcaagca acccacggat acggttcctc ctgttgacaa
    5701  tggcaagccc gacataagca aacctggtga gaaacaggga gacatagata
    5751  ttgctagcaa gtttaataat atagtcatgg caaaattgaa agctcaatct
    5801  tcatcagatc cattgacgaa aaagcaatgt gatcaattga tgttgagtct
    5851  aatcaaatgg tttgaaaaat ttggaatcac aaaagacaat gcccgattgc
    5901  tgatatttca atttggtata tctttttcga cttcaaaaga aaatcttaac
    5951  aatatcacta acaatattgt tgtagagaat gacaaaggtg ggtttgtaaa
    6001  aattttaaaa atagattact tgaacaaact gtacggttcg attcctgagt
    6051  cgcatactca caatttagaa agagttctac taagacatta tgctcaagaa
    6101  atcttaatat tactaagaag caaagtgtta gaatggccta ggaaattagc
    6151  aagaaataag ggcattttcg aacaatatgc ctacatggcc tgtgactttt
    6201  tcgacaccgc agaattagaa ttgacggagg ctgagaccac agctttgacg
    6251  acggtaaagt cttggactat gaaccattat aagaagaaaa gacagatagt
    6301  taatagttca caattagaat gaataatttt cctgaaattt ttgatgatga
    6351  atccacatgc gactatgata aagagataga tcaccaagaa ctatcagata
    6401  ccttttggtg tttgatggat ttcatctctt ctaaacatgg gaaaagtgtc
    6451  gctgatataa attcagggat gaatactttg attaacatta gaaagagcct
    6501  caatggaagt ggtaaagttg tgtcgataac tgatagttac aataaaactt
    6551  atttccacag tcaaagagga ttgaccaatg ttgactcaag gataaacata
    6601  gatatattga agatagattt cattagtatt attgacgatc ttcaaataat
    6651  atttagaggt ttaatttaca aagataaagg ttttctagat agtgcggact
    6701  tgttagattt agataagaaa acaactacta gaaaatttca agaatatttc
    6751  aatattctaa aaataaaaat catagagaaa attggaatga caaaaacatt
    6801  ccatttcaat atagatttta gaaacacgat ctctccttta gataagcaaa
    6851  ggaaatgttc aatttcaagt tctcataaga aaaccaacag attgaacgat
    6901  ctcaataatt atataacata tctaaatgat aatattgtgt tgacatttag
    6951  atggaaagga gtaggattcg gaggactatc attaaatgat ataaaaattt
    7001  aaaacacaag cgggtaagtt ggataaggta atatccgcaa ggtcgaatag
    7051  ggtttgtatt aatcagacta tttgtaaatc cttaaaagag acatgaacga
    7101  taattcaatt tgatcagaga gtggtgattg aattattcga tgataaatgg
    7151  tttaaaacca tttatcattc tagtgtatct cgtatactag acc