!!NA_SEQUENCE 1.0
ID   TOTRVRG2   standard; genomic RNA; VRL; 1905 BP.
XX
AC   X03686;
XX
SV   X03686.1
XX
DT   18-NOV-1986 (Rel. 10, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Tobacco rattle virus strain PSG RNA2
XX
KW   capsid protein.
XX
OS   Pepper ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-1905
RX   MEDLINE; 86176720.
RX   PUBMED; 3960718.
RA   Cornelissen B.J.C., Linthorst H.J.M., Brederode F.T., Bol J.F.;
RT   "Analysis of the genome structure of tobacco rattle virus strain PSG";
RL   Nucleic Acids Res. 14(5):2157-2169(1986).
XX
CC   Data kindly reviewed (11-AUG-1986) by J.F. Bol
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1905
FT                   /db_xref="taxon:31750"
FT                   /mol_type="genomic RNA"
FT                   /organism="Pepper ringspot virus"
FT   precursor_RNA   475. .>475
FT                   /note="put. subgenomic RNA4"
FT   CDS             571. .1200
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProt/Swiss-Prot:P69470"
FT                   /note="put. capsid protein (aa 1-209)"
FT                   /protein_id="CAA27322.1"
FT                   /translation="MGDMYDEQFDKAGGPADLMDDSWVESTAWKDLLKKLHSVKFALQS
FT                   GRDEITGLLTTLSRQCPYSPYEQFPERKVYFLLDSRANNALGVIQNASAFKRRADEKNA
FT                   VAGVTNIPANPNTTVTTNQGSTTTTKANTSSTLEEDLYTYYKFDDASTTFHKSLTSLEN
FT                   MQLKSYYRRNFEKNFGVKFGSASTPASGGSGATPPPASGGAVRPNP"
FT   misc_feature    1409. .1905
FT                   /note="seq. identical to 3' terminal seq. in PSG RNA1"
XX
SQ   Sequence 1905 BP; 559 A; 338 C; 436 G; 572 T; 0 other;

   X03686  Length: 1905  May 10, 2005 10:09  Type: N  Check: 6935  ..
       1  ataaaacatt gcacctttgg ctgtcgcccc tggctggggt atgtctttga
      51  acgcagtaga atgtgctaat tgacaagttg gagaacgcgg tagaacgtac
     101  ttatccgaca ggcctttatc cctcttcctg acgaggtttt tgtcagtgta
     151  tcatgttgtt ttgaactatc caacttagta ccggaatggg aaagtgattg
     201  gtgtgcttat cttcgatatg atgctttgaa ttttgcatag taggaagtta
     251  gaaaagaaac tcttgtcttc tcaaacaagt aaaacctgag acgtgttaac
     301  tacgaaagtg tccattcaaa atatcatgaa cgaacgtagt ttgtttgtgg
     351  ttaccaaaaa cgataagaac acctttaagg ttttctttac gcaagtgttc
     401  gccagaacac tggggttttg tcagtttctt tagagaaaac tgactaagtt
     451  tctaatgtta tcattagaga tggcataaat aaactgtttg tgtctgctga
     501  taagatcatt tttactttga cagttagctt tgctgaacta ctggttactg
     551  aatcacttac gctaactaac atgggtgaca tgtacgatga gcaattcgat
     601  aaggcgggag ggcctgcaga tttgatggat gactcatggg ttgagtctac
     651  agcttggaaa gatcttttaa agaaactgca tagcgtaaaa tttgcgctac
     701  agtctggtag agatgagatc accggtttgc tgaccactct cagtagacag
     751  tgtccttatt cgccgtacga acagtttcct gaaagaaagg tttacttttt
     801  gttagactca cgtgctaata acgctctcgg tgttattcag aacgcttctg
     851  ccttcaagag gagagccgat gagaagaatg ctgtagctgg tgttacaaat
     901  ataccagcca atccaaatac cacggtcact acaaatcaag gtagtactac
     951  tactacgaag gcgaacacaa gctcgacttt ggaggaggat ctgtatactt
    1001  attacaaatt cgatgacgcc tcgacaacat ttcataaatc tctgacgtcg
    1051  ttggaaaata tgcaactgaa gagttattat cgaagaaatt ttgagaagaa
    1101  ctttggtgtc aaatttggta gcgcgtcgac tccggcctcg gggggaagtg
    1151  gtgcaacacc acctcctgcg agtgggggtg ctgtgcgtcc taatccttga
    1201  tgtcgtcaaa tcaaaccttt aagggacctt gtgaaattca aggggcgggt
    1251  gtcgccagaa atcaccgata ctactagttg tatcaaaaca aaactaatca
    1301  caacttgcat tttactagtg catgttgaat tcctgtggaa gtcaggaggt
    1351  ggatgttacc ataaacatta atgtcgcagg tggcatttta aaataagacc
    1401  tgatacgatg tataattgtt gtggccgtag ccaccttgaa aagtgtcgta
    1451  aacgcgttga agcaagaaat cgagagatct ggaaacagat tcgacgaatt
    1501  caagctgaaa gctcgtctgc gacacgtaaa aagtctcata attcaaagaa
    1551  ctctaagaag aaattcaaag aggacagaga atttggggca ccaaaaagat
    1601  ttttaagaga tgatgttcct ttgggaattg atcaattgtt tgttttttga
    1651  ttttatttta aattgttatc tgtttctgtg tatagactgt ttgagattgg
    1701  cgtttggccg actcattgtc ttaccatagg gaaacggact ttgtttgtat
    1751  tgttatttta tttgtatttt attaaaattc tcaatgatct gaaaaagctt
    1801  cgcggctaag agattattgg ggggtgagta agtactttta aagtgatgat
    1851  ggttacaaag gcaaaagggg taaaacccct cgcctacgta agcgttatta
    1901  cgccc