!!NA_SEQUENCE 1.0
ID   TOTRVRN2   standard; genomic RNA; VRL; 3389 BP.
XX
AC   X03955;
XX
SV   X03955.1
XX
DT   18-NOV-1986 (Rel. 10, Created)
DT   17-NOV-2004 (Rel. 81, Last updated, Version 5)
XX
DE   Tobacco rattle virus (TRV) strain TCM RNA2 sequence
XX
KW   coat protein.
XX
OS   Pepper ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-3389
RX   MEDLINE; 86232599.
RX   PUBMED; 3714489.
RA   Angenent G.C., Linthorst H.J.M., van Belkum A.F., Cornelissen B.J.C.,
RA   Bol J.F.;
RT   "RNA 2 of tobacco rattle virus strain TCM encodes an unexpected gene";
RL   Nucleic Acids Res. 14(11):4673-4682(1986).
XX
CC   The sequence of the 3'-terminal 1099 nucleotides (starting at
CC   position 2291) of RNAs 1 and 2 was found to be identical.
XX
CC   Data kindly reviewed (08-AUG-1986) by J.F. Bol
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3389
FT                   /db_xref="taxon:31750"
FT                   /mol_type="genomic RNA"
FT                   /organism="Pepper ringspot virus"
FT   misc_feature    1. .3389
FT                   /note="TCM RNA2"
FT   misc_feature    438. .438
FT                   /note="5'-terminus of subgenomic RNA 4"
FT   CDS             547. .1164
FT                   /db_xref="GOA:P05072"
FT                   /db_xref="UniProt/Swiss-Prot:P05072"
FT                   /note="coat protein (aa 1-205)"
FT                   /protein_id="CAA27584.1"
FT                   /translation="MAGSYGETFDGKILDDLSGAWVEKHNWSDILRRLTKIKFALQADR
FT                   DMIPGIVEDLSTEIPVDENTRFPSGKVYHLLTKEMLMAIEAIHAASSFKRRAEEKNNVN
FT                   PRQRFEAESSSSQLPSGGLVVRPAAGSGDSSLGEDLFSNSKLDDASTAFHKSLATLKGS
FT                   RPKAVVQRTFEKEYSLRWTAAAPVAAAGGTPPGGRSWTWNLV"
FT   misc_feature    1257. .1257
FT                   /note="put. 5'-terminus of subgenomic RNA 6"
FT   CDS             1282. .2049
FT                   /db_xref="GOA:P05078"
FT                   /db_xref="UniProt/Swiss-Prot:P05078"
FT                   /note="29.1 K protein (aa 1-255)"
FT                   /protein_id="CAA27585.1"
FT                   /translation="MGNGDWSSKWPNDHLFIDDFGKLVWFDVLTDIVKISHFVSQVPTD
FT                   LSPIPSSYISFIDGRIPMCINHLGWVYIRVKFESEEVFYQKFGEVDVSRFGESELPPDF
FT                   EVTFSKVTTLVNKSLVRKSELLEKMNNELKQELTNKLDSLEKVNVQLKKELSQAQQSNF
FT                   TELRDGLILNFSKVGGRIHRMVVRSIQNQLKLVSEINNDGDRWATMGATVILKEGAQYL
FT                   GFVVVKNDGKIGVKFDLTRLNSLDNQTLLASVV"
FT   CDS             <2292. .2684
FT                   /db_xref="UniProt/Swiss-Prot:P05074"
FT                   /note="28.8 K protein fragment"
FT                   /protein_id="CAA27586.1"
FT                   /translation="ACDNCSVAQYKVEYSISTQENVLDVWKVGCISEGVPVCDGTYPFS
FT                   IEVSLIWVATDSTRRLNVEELNSSDYIEGDFTDQEVFGEFMSLKQVEMKTIEAKYDGPY
FT                   RPATTRPKSLVSSEDVKGASKKKNSS"
FT   misc_feature    2688. .2688
FT                   /note="put. 5'-terminus of subgenomic RNA 5"
FT   CDS             2709. .3134
FT                   /db_xref="UniProt/Swiss-Prot:P05076"
FT                   /note="16 K protein (aa 1-141)"
FT                   /protein_id="CAA27587.1"
FT                   /translation="MTCVLKGCVNEVTVLGHETCSIGHANKLRKQVADMVGVTRRCAEN
FT                   NCGWFVCVIINDFTFDVYNCCGRSHLEKCRKRFEARNREIWKQVERIRGEKASATVKKS
FT                   HKSKPSKKKFKERKDFGTPKRFLRDDVPLGIDQLFVF"
XX
SQ   Sequence 3389 BP; 962 A; 559 C; 832 G; 1036 T; 0 other;

X03955  Length: 3389  November 23, 2004 08:41  Type: N  Check: 8903  ..
       1  ataaaacatt gcaccaatgg tgctgccctg gctggggtat gtctttgaac
      51  gcagtagaat gtgctaattg acaagttgga gaacgcggta gaacgtactt
     101  atccgacaca gcctttatcc ctttgttgag aggtttttct caactgcacc
     151  gaaattctgg atttagttgg tcgctagaag actgaaggaa tgtaggtgta
     201  tttttagata gttaataggt atcttctcaa ataccataaa catgagacgc
     251  atcgcttgcg aaagtagcat taaaagctaa accttactaa atgacaaatt
     301  ttagtttggt ggttcaaaaa cgtcactcaa agtcaatttg agtgtgcgca
     351  gaacagaacg atgtcacgtt cctgttcggg gtttcacact atcttaagag
     401  aaagtgttaa aatagtgaga atattctcac tatgagcata attatactgg
     451  ttatcctctc gctgatagag actatcattc ttaaaatcac tttgaaaggt
     501  agtcttgttg atacacaggt tgctttatca cttgcactac ttacttatgg
     551  caggtagtta tggggaaacg ttcgatggaa aaattctcga cgatctctct
     601  ggggcttggg ttgagaaaca taactggagc gacatcctcc gaaggttgac
     651  gaagatcaaa tttgctctcc aggcagacag agatatgatc cctggaattg
     701  ttgaggatct gagtacggaa ataccagttg atgaaaacac gaggtttcct
     751  agtgggaaag tgtatcacct tctgaccaag gaaatgttga tggcgatcga
     801  agctatccat gcggcttcgt cgttcaaaag aagagccgag gagaaaaata
     851  atgtcaatcc gagacagaga tttgaagccg aaagttcgtc ttcacagtta
     901  ccatctggtg gtttagtagt tagacctgct gctgggagtg gggattcatc
     951  gttaggtgaa gatttgtttt cgaatagtaa attagatgac gccagtacgg
    1001  cctttcataa gagtttagct actcttaagg gaagtcgtcc aaaggcggtt
    1051  gtccagcgca ctttcgaaaa agagtatagt ttgaggtgga cggctgctgc
    1101  tccggtcgct gctgctggtg gaacaccacc aggtggaagg tcgtggacct
    1151  ggaacctagt ttgaatacta gatttcgata atgacagcaa ttgtcatttt
    1201  agaaacggtt ttgctacttg atttggttta atcctttgac atgggtcgca
    1251  ggtggcatag taattgtgaa atttcttctt tatgggcaac ggagattggt
    1301  cttcaaagtg gcctaacgat cacttgttca tagatgattt cggaaagttg
    1351  gtttggttcg atgtactgac tgacatagtt aagatctctc atttcgtttc
    1401  acaggtacca accgatttgt ctccaattcc gagctcctat attagcttca
    1451  tcgatggtcg aattcccatg tgtatcaatc acctaggttg ggtgtatata
    1501  cgtgttaaat ttgagtctga ggaagtattt tatcagaagt tcggtgaggt
    1551  agatgttagt aggttcggcg agtcggaact tcctccggat ttcgaagtca
    1601  ctttcagtaa ggtgactacg ctggtgaata agtccttggt gcgaaaaagc
    1651  gagcttctcg aaaagatgaa caatgaactc aaacaggaat taactaacaa
    1701  gcttgattcg ctggaaaagg taaatgttca gttaaagaag gaacttagtc
    1751  aagcgcaaca aagtaatttc actgaattgc gcgacgggtt gatcttaaac
    1801  ttttcaaaag ttggcgggag aatccatcgt atggttgtca gatccatcca
    1851  aaatcagctt aagcttgttt cggaaatcaa taatgatggt gacaggtggg
    1901  ctacaatggg agctacggta attctaaagg aaggagctca gtatttaggg
    1951  tttgttgttg taaagaatga tgggaaaatc ggtgtcaaat tcgatttaac
    2001  caggttaaat tctttggata accaaacttt gctggcgtct gtggtttaat
    2051  atgttgtagg tttaaactcc ttttgagcgg ggcgtgaaag tcgtccggtg
    2101  gatcgtacct tatcgatttc tgttgtagga agcagataaa ataattcctg
    2151  tagctacgtc tcacgtaggg tggttgttac cataaacaat aatgtcgttg
    2201  gttgcattta aaataattcc attgaccgat attctatcat gggaaacgtc
    2251  tgcagggcgt tcttgataag cttaactccg cagttacatt agcttgcgat
    2301  aattgttcag ttgcgcagta caaggttgaa tacagtattt ctacacaaga
    2351  gaatgtactc gatgtctgga aggtgggttg tatctctgag ggcgttccgg
    2401  tctgtgacgg cacataccct ttcagtattg aagtgtcgct catttgggtt
    2451  gctactgatt cgactagacg tcttaatgtg gaagaactga acagttcaga
    2501  ctacattgaa ggcgatttta ccgatcagga ggttttcggt gagttcatgt
    2551  ctttgaaaca agttgagatg aagacgattg aggcgaagta tgatggtccg
    2601  tacagaccag ctactactag accaaaatca ttggtgtcaa gtgaagatgt
    2651  taagggagcg tctaaaaaga aaaactcgtc ttaatgcata aagaaattta
    2701  ttgtcactat gacgtgtgta ctcaagggtt gtgtgaatga agtcactgtt
    2751  cttggtcacg agacgtgtag tatcggtcat gctaacaagt tgcgaaagca
    2801  agttgctgac atggttggtg tcacacgtag gtgtgcggaa aataattgtg
    2851  gatggtttgt ctgtgttatt atcaatgatt ttacttttga tgtgtataat
    2901  tgttgtggcc gtagtcacct tgaaaagtgt cgtaaacgct tcgaagcgag
    2951  aaatcgggaa atctggaaac aggttgaacg aattcgaggt gaaaaggcgt
    3001  ctgctacggt taaaaagtct cataaatcga aaccctctaa gaagaaattc
    3051  aaggagagaa aagattttgg gacaccaaaa agatttttaa gagatgatgt
    3101  tcctttggga attgatcaat tgtttgtttt ttgattttat tttaaattgt
    3151  tatctgtttc tgtgtataga ctgtttgaga ttggtgtttg accaactcat
    3201  tgtcttacca taggggaacg gactttgttt gtgttgttat tttatttgta
    3251  ttttattaaa attctcaatg atctgaagaa gctttattgc taagagatta
    3301  ttggggggtg agtaagtact tttaaagtga tgatggttac aaaggcaaaa
    3351  ggggtaaaac ccctcgccta cgtaagcgtt attacgccc