!!NA_SEQUENCE 1.0
ID   NEGFLVR2   standard; genomic RNA; VRL; 3774 BP.
XX
AC   X16907;
XX
SV   X16907.1
XX
DT   08-AUG-1990 (Rel. 25, Created)
DT   17-NOV-2004 (Rel. 81, Last updated, Version 4)
XX
DE   Grapevine Fanleaf virus (GFLV-F13) RNA2 encoding capsid protein
XX
KW   capsid protein; polyprotein; subgenome.
XX
OS   Grapevine fanleaf virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Nepovirus; Subgroup A.
XX
RN   [1]
RP   1-3774
RA   Pinck L.;
RT   ;
RL   Submitted (13-OCT-1989) to the EMBL/GenBank/DDBJ databases.
RL   Pinck L., Institut de Biologie Moleculaire des Plantes du CNRS (IBMP), 12
RL   rue du G1 Zimmer 67084 Strasbourg-Cedex, France.
XX
RN   [2]
RP   1-3774
RX   MEDLINE; 90324929.
RX   PUBMED; 2374004.
RA   Serghini M.A., Fuchs M., Pinck M., Reinbolt J., Walter B., Pinck L.;
RT   "RNA2 of Grapevine Fanleaf Virus: sequence analysis and coat protein
RT   cistron location";
RL   J. Gen. Virol. 71:1433-1441(1990).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3774
FT                   /db_xref="taxon:12274"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine fanleaf virus"
FT                   /strain="F13"
FT   CDS             233. .3562
FT                   /db_xref="GOA:P18474"
FT                   /db_xref="UniProt/Swiss-Prot:P18474"
FT                   /note="polyprotein (AA 1-1109)"
FT                   /protein_id="CAA34779.1"
FT                   /translation="MGKFYYSNRRLACWAAGKNPHLGGSVEQWLAAINTDPSFRQTVKE
FT                   DVQENREQPTAVRMFSWKVGSGPIDNPEKCDWHFVLTGERPAPSRPVKADEVVVVPQPK
FT                   KVVIPTPPPPPAPYFRAVGAFAPTRSEFVRAIVERLTRLREESRAAALFAELPLEYPQG
FT                   APLKLSLAAKFAMLKHTTWRKWYDTSDERLLEAHPGGPCLPPPPPIQNPPSFQERVREF
FT                   CRMKSCTKAFALETSLGLNKAWVGLVDIPSTSVCCADGKTTGGQTIAQEADPLQHRIST
FT                   SVAPGRAQWISERRQALRRREQANSFEGLAAQTDMTFEQARNAYLGAADMIEQGLPLLP
FT                   PLRSAYAPRGLWRGPSTRANYTLDFRLNGIPTGTNTLEILYNPVSEEEMEEYRDRGMSA
FT                   VVIDALEIAINPFGMPGNPTDLTVVATYGHERDMTRAFIGSASTFLGNGLARAIFFPGL
FT                   QYSQEEPRRESIIRLYVASTNATVDTDSVLAAISVGTLRQHVGSMHYRTVASTVHQAQV
FT                   QGTTLRATMMGNTVVVSPEGSLVTGTPEARVEIGGGSSIRMVGPLQWESVEEPGQTFSI
FT                   RSRSRSVRIDRNVDLPQLEAEPRLSSTVRGLAGRGVIYIPKDCQANRYLGTLNIRDMIS
FT                   DFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRITASADPVYT
FT                   LSVPHWLIHHKLGTFSCEIDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQA
FT                   VVELYAELEEATSFLGKPTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQV
FT                   PMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAPIFYSIVLWVVSEWNGTTMDWNELF
FT                   KYPGVYVEEDGSFEVKIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETAQLP
FT                   IVVQIDEIVRPDLSLPSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDFTSNTCRVSMGEN
FT                   PFAAMIACHGLHSGVLDLKLQWSLNTEFGKSSGSVTITKLVGDKAMGLDGPSHVFAIQK
FT                   LEGTTELLVGNFAGANPNTRFSLYSRWMAIKLDQAKSIKVLRVLCKPRPGFSFYGRTSF
FT                   PV"
FT   CDS             <2048. .3562
FT                   /db_xref="GOA:P18474"
FT                   /db_xref="UniProt/Swiss-Prot:P18474"
FT                   /note="capsid protein (AA 606-1109)"
FT                   /protein_id="CAA34780.1"
FT                   /translation="GLAGRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGL
FT                   VMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRITASADPVYTLSVPHWLIHHKLGTF
FT                   SCEIDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQAVVELYAELEEATSFL
FT                   GKPTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTL
FT                   VSCVLGMGGTVRGRVHICAPIFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSFEV
FT                   KIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETAQLPIVVQIDEIVRPDLSL
FT                   PSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDFTSNTCRVSMGENPFAAMIACHGLHSGV
FT                   LDLKLQWSLNTEFGKSSGSVTITKLVGDKAMGLDGPSHVFAIQKLEGTTELLVGNFAGA
FT                   NPNTRFSLYSRWMAIKLDQAKSIKVLRVLCKPRPGFSFYGRTSFPV"
XX
SQ   Sequence 3774 BP; 915 A; 812 C; 954 G; 1093 T; 0 other;

X16907  Length: 3774  November 23, 2004 08:41  Type: N  Check: 4423  ..
       1  atgaaaaatg tttacgtttt cttacgttac cgtgatttca cttttcttta
      51  gccaagagtt taagaaactc aaaagtgaaa ctgccaagag tttaagaaac
     101  tcacaaagcg aagagtttaa gaaactcatc attgcttttt tgttctttta
     151  ttttgcgctt tatttgttta gcattttatt tagttctttt aaaaagcttt
     201  tgttttgttt ttctttttct ttacttgccc ttatgggcaa attttattat
     251  tccaacaggc ggcttgcctg ttgggctgct gggaagaacc ctcatcttgg
     301  gggttctgtt gaacaatggc tggcggccat taacactgat ccctccttcc
     351  gccaaactgt taaggaggat gtccaagaaa accgagaaca gccaactgct
     401  gttcgaatgt tttcttggaa agttgggtcc gggcccattg acaatcccga
     451  gaaatgcgac tggcattttg tccttacggg cgagaggcca gcgccgtccc
     501  ggccggttaa agccgatgag gttgtggtgg tgccacaacc gaagaaggtg
     551  gtgattccaa caccacctcc tcccccagct ccctacttta gggctgttgg
     601  ggcttttgca ccaacccggt ccgagtttgt tcgggccatt gtggaaaggc
     651  tcacccggct acgggaggag tcgagagctg cggcactctt tgccgaattg
     701  ccattggagt accctcaggg tgctcctctg aagttgagcc tggcggcgaa
     751  attcgccatg ctcaaacata ccacttggag gaagtggtat gacactagtg
     801  atgagcgcct tttggaggct catcctggtg gtccttgtct tcctccccct
     851  cccccaatcc aaaatcctcc ctccttccag gagagggtga gggagttttg
     901  caggatgaag tcctgcacca aggctttcgc cttggaaacc tccctaggtc
     951  tcaataaggc ctgggtaggt ttagtggaca tccccagtac ttctgtgtgc
    1001  tgtgcggatg ggaagactac cggtgggcag acaattgccc aggaagctga
    1051  tcctttgcaa cataggatca gtacgtcagt agcccccggt agggcacaat
    1101  ggatctccga gcgcagacaa gctctgcgga ggagagagca agcaaatagc
    1151  ttcgaaggtc ttgctgctca aaccgatatg acttttgagc aggccaggaa
    1201  tgcttatctt ggtgctgccg acatgattga gcaaggccta ccgctgcttc
    1251  cccctctgcg cagcgcttac gcccctaggg gtttgtggag gggaccctca
    1301  accagagcca attacacgct agattttagg ctcaatggta ttccgaccgg
    1351  gacaaacaca ttggaaatat tgtataatcc tgtgtcggag gaagagatgg
    1401  aagagtaccg ggacaggggc atgtcagctg tggtaattga tgcgctagaa
    1451  atagccataa acccatttgg catgcctgga aatcctacgg acttgactgt
    1501  cgtagcgaca tatgggcatg agcgcgacat gacgcgcgcc tttattggat
    1551  ctgcttccac attcttaggg aatgggttag ctagagccat tttctttcct
    1601  ggtttgcaat atagccagga ggaaccaagg cgcgaatcta taattcgcct
    1651  atatgttgcc tctaccaatg ccactgtgga tactgattca gtcttggcag
    1701  ccattagtgt tggcactttg cgtcaacatg ttggttccat gcactaccgg
    1751  acagtggcta gtaccgtgca ccaggctcag gtgcaaggaa cgacgctcag
    1801  ggctactatg atgggtaaca ctgtcgtagt atcacctgaa ggaagcctgg
    1851  ttactggaac ccctgaagca agagttgaaa tagggggcgg ttctagtatt
    1901  aggatggtgg gacctctaca gtgggaaagt gtggaggaac cagggcaaac
    1951  cttctctatc agaagccgtt cacggtctgt gaggattgat agaaacgttg
    2001  atcttcctca acttgaggct gagcccagac tgagctcaac cgtgagagga
    2051  ttagctggta gaggagtaat ctacattccc aaggattgcc aggcaaatag
    2101  atacttgggc accctgaata tacgtgatat gatctcagac ttcaagggtg
    2151  tccagtatga aaagtggata actgcaggat tagtcatgcc tactttcaag
    2201  atagttatta ggctacctgc aaatgccttt actggattga catgggtgat
    2251  gagctttgat gcttataacc ggataactag tagaattact gctagtgcgg
    2301  atcctgtata caccttgtca gtcccacatt ggcttatcca ccataagttg
    2351  ggcacgtttt catgtgagat agactatgga gaattgtgtg gtcatgctat
    2401  gtggtttaaa tcaaccacat ttgaatctcc aaggttgcat ttcacgtgtt
    2451  taacgggcaa caacaaagag ttagcggcag actggcaagc tgtcgtagaa
    2501  ctatatgccg aattggaaga ggccacttct ttccttggga aaccaacttt
    2551  ggtttttgac ccaggtgttt tcaatggcaa atttcaattt cttacttgcc
    2601  ctcccatatt ctttgattta acggccgtca cggcccttag gagtgctggg
    2651  ctgacattgg ggcaagtccc aatggttggc accactaagg tttataatct
    2701  aaacagcact cttgtgagtt gtgttttggg tatgggaggt actgttagag
    2751  ggagggtgca catttgtgcg ccaatcttct acagtattgt tttatgggtc
    2801  gttagtgagt ggaacgggac cactatggac tggaatgaac tttttaagta
    2851  tcccggggtg tatgtggaag aggacggaag ttttgaagta aagattcgct
    2901  ctccatatca ccgaactcct gccagattgc ttgctggtca aagtcagaga
    2951  gacatgagct ctcttaattt ttatgcaata gcaggaccta tcgctccttc
    3001  gggtgagact gcgcaacttc ctattgttgt gcagatagat gaaattgtgc
    3051  gcccagatct ctctttacca agttttgaag atgactattt cgtatgggtg
    3101  gatttttctg aattcactct tgataaagaa gaaattgaga ttggttctcg
    3151  tttcttcgat ttcacttcga atacttgtag ggtatctatg ggtgaaaatc
    3201  cgtttgctgc aatgattgcc tgccatggat tgcatagtgg tgtattagac
    3251  ctcaaactcc aatggagtct gaacaccgaa ttcggcaaga gcagcgggag
    3301  cgttaccatc acgaagctgg tgggtgataa ggccatgggt ctggacggac
    3351  cttctcacgt ttttgccata caaaaactag agggaactac agagttgttg
    3401  gttgggaatt ttgcaggagc aaacccaaac actcgttttt ccctttatag
    3451  tcgctggatg gcaattaaat tggatcaagc aaagagtatt aaagtactcc
    3501  gcgttttgtg caagccccgt ccaggcttta gcttttatgg tagaaccagt
    3551  ttcccagtct agggtatctg actttaaaag acccaagtgt atatatgtgt
    3601  tttgtcagta gcatgtatta ttttgtgtta taatttgttt taacttgttt
    3651  tccgcttttg tgtgtttagt ttcatgcttt tagtggcgac agtgtgttgt
    3701  ttgtcctttg gacacacttg cctagttgga cgcaaaaaga tttttccttt
    3751  ctttttactg ttttgcaaat ttat