!!NA_SEQUENCE 1.0
ID   GVFVCP     standard; RNA; VRL; 2305 BP.
XX
AC   X60775;
XX
SV   X60775.1
XX
DT   11-OCT-1991 (Rel. 29, Created)
DT   11-OCT-1991 (Rel. 29, Last updated, Version 2)
XX
DE   Grapevine fanleaf virus genomic RNA for capsid protein
XX
KW   capsid protein; capsid protein gene.
XX
OS   grapevine fanleaf virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Nepovirus.
XX
RN   [1]
RP   1-2305
RA   Ponz F.;
RT   ;
RL   Submitted (24-JUN-1991) to the EMBL/GenBank/DDBJ databases.
RL   F. Ponz, CIT-INIA, Departamento Proteccion Vegetal, Carretera La Coruna Km
RL   7,5-28040 Madrid, SPAIN
XX
RN   [2]
RX   MEDLINE; 92020245.
RA   Sanchez F., Chay C., Borja M.J., Rowhani A., Romero J., Bruening G.,
RA   Ponz F.;
RT   "cDNA sequence of the capsid protein gene and 3' untranslated region of a
RT   fanleaf isolate of grapevine fanleaf virus";
RL   Nucleic Acids Res. 19:5440-5440(1991).
XX
DR   SPTREMBL; Q67703; Q67703.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2305
FT                   /db_xref="taxon:12274"
FT                   /organism="grapevine fanleaf virus"
FT                   /strain="fanleaf"
FT                   /clone="viral cDNA"
FT   CDS             579. .2093
FT                   /db_xref="SPTREMBL:Q67703"
FT                   /note="no ATG start"
FT                   /product="capsid protein"
FT                   /protein_id="CAA43186.1"
FT                   /translation="GLAGRGVVYIPKDCQANRYLGTLNIRDMILDFKGVQYEKWITAGL
FT                   VMPIFKIVVRLPANAFTGLTWVMSFDAYNRITSRITASADPVYTLSVPHWLIHHKLGTF
FT                   SCEIDYGELCGHAMWFKTTTFESPRLHFTCLTGNNKELAADWQAVVELYAELEEATSFL
FT                   GKPTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALKSAGLTLGQVPMVGTTRVYNLNSTL
FT                   VSCVLGMGGTIRGKVHICAPIFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSSEV
FT                   KIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETARLPIVVQIEEIVRPDLSL
FT                   PSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDYTSSTCRVSMGENPFAAMIACHGLHSGV
FT                   LDLKFQWSLNTEFGKSSGSVTITKLVGDKATGLDGPSQVFAIQKLEGATELLIGNFAGA
FT                   NPNTHISLYSRWMAIKLDQAKSIRVLRVLCKPRPGFSFYGRTSFPV"
FT   3'UTR           2094. .2304
FT   polyA_site      2304
XX
SQ   Sequence 2305 BP; 583 A; 435 C; 573 G; 714 T; 0 other;

X60775  Length: 2305  December 21, 2001 16:02  Type: N  Check: 9174  ..
       1  gcatgcctgg gaatccaacg gacttgaccg tcgtagcaac atatgggcat
      51  gagcgtgata tgacacgtgc ctttattgga tctgcttcca cctttttagg
     101  gaatgggtta gctagagcca ttttctttcc tggtttgcaa tatagccagg
     151  aggaaccaag gcgcgaatct ataattcgcc tttatgttgc ctctactaat
     201  gctactgtag atactgattc agttttggca gccattagtg ttggaacttt
     251  gcgacaacac gttggctcca tgcactatcg gacagtagct agtactgtgc
     301  accaagccca ggtgcaagga acaacgctca gggctactat gatgggtaac
     351  actgttgtgg tatcacctga aggaagcttg gttactggaa cccctgaagc
     401  aagagttgaa attgggggcg gttccagtat taggatggtg ggacctctcc
     451  aatgggaaag cgtagaggaa ccagggcaaa ccttctctat cagaagtcgt
     501  tcacgatctg tgaggattga tagaaacgtt gatcttcctc aacttgaggc
     551  tgaacccaga ctgagttcaa ccgtgagagg attggctggt agaggagtgg
     601  tttatatccc taaggattgc caggcaaaca gatacttggg caccctgaac
     651  atacgtgata tgattttaga ttttaagggt gttcagtatg aaaagtggat
     701  aactgcagga ttggtcatgc ctatttttaa gatagttgtt aggctacctg
     751  caaatgcctt taccggattg acgtgggtga tgagttttga tgcttataac
     801  cggataacta gtagaatcac tgctagtgca gatcctgtgt acaccctatc
     851  agttccacat tggcttatcc accataagtt gggcacgttt tcatgtgaaa
     901  tagactatgg agagttgtgc ggtcatgcta tgtggttcaa gaccacgaca
     951  tttgaatctc caaggttgca tttcacgtgc ctaacgggta acaataaaga
    1001  gttggcggca gactggcaag ctgttgtcga actttatgct gaattggaag
    1051  aggccacttc ttttcttggg aaaccaactt tggtttttga cccaggtgtt
    1101  tttaatggta aattccaatt tctcacttgc cctcccatat tcttcgattt
    1151  gacggccgtc acggctctta agagtgctgg gctgacattg ggacaagtcc
    1201  caatggttgg cactactagg gtttataatc taaatagcac tctcgtaagc
    1251  tgtgttttgg gtatgggagg tactattaga ggaaaggtgc acatttgtgc
    1301  tccaatcttc tatagtattg ttttgtgggt cgttagtgag tggaacggga
    1351  ccactatgga ttggaatgaa ctttttaagt atcccggggt gtatgtggaa
    1401  gaggacggaa gttctgaagt caaaattcgc tctccatatc accgaacgcc
    1451  tgctagattg cttgctggtc aaagtcagag ggacatgagc tctctaaatt
    1501  tttacgcaat agcagggcct atcgctccat cgggtgagac tgcgcgactt
    1551  cctatcgttg tgcagattga agaaattgtg cgcccggact tatctctacc
    1601  aagctttgaa gatgattatt ttgtatgggt ggatttttct gagttcaccc
    1651  ttgacaaaga agaaattgag attggatctc gttttttcga ttatacttca
    1701  agcacttgta gagtgtctat gggagaaaat ccgtttgctg caatgattgc
    1751  ctgtcatgga ttacatagtg gtgttctgga tctcaaattt cagtggagtt
    1801  tgaacaccga atttggcaag agcagcggga gcgttactat cacaaaactg
    1851  gtgggtgata aagccacggg tctggacggg ccttcacagg tttttgccat
    1901  acaaaaacta gagggagcta cagaattgtt gattgggaat tttgcaggag
    1951  caaacccaaa tactcatatc tccctctata gtcggtggat ggcaattaaa
    2001  ctggatcaag caaagagtat tagagtactc cgtgttttgt gtaagcctcg
    2051  tccaggtttc agtttttatg gaagaaccag ttttccagtc tagggtatct
    2101  gactttaaaa gacccgcgtg tatatatgta atttattaat tgcatgtgtt
    2151  attttgtatt gtagtttgct ttaacttgtt tactgcttta gtgtgtttaa
    2201  tttcatgctt ttagtggcga cagtgtgttg tttgtccttt ggacacactt
    2251  gccttgttgg acacaaaaag attttctttt ctttttactg ttttgcaaat
    2301  ttata