!!NA_SEQUENCE 1.0
ID   TPCTVCD    standard; genomic DNA; VRL; 2861 BP.
XX
AC   X84735;
XX
SV   X84735.1
XX
DT   28-JUN-1996 (Rel. 48, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Tomoato pseudo-curly top virus complete DNA sequence
XX
KW   coat protein.
XX
OS   Tomato pseudo-curly top virus
OC   Viruses; ssDNA viruses; Geminiviridae; Topocuvirus.
XX
RN   [1]
RX   DOI; 10.1006/viro.1996.0264.
RX   MEDLINE; 96213508.
RX   PUBMED; 8638404.
RA   Briddon R.W., Bedford I.D., Tsai J., Markham P.G.;
RT   "Analysis of the nucleotide sequence of the treehopper-transmitted
RT   geminivirus, tomato pseudo-curly top virus, suggests a recombinant
RT   origin.";
RL   Virology 219(2):387-394(1996).
XX
RN   [2]
RP   1-2861
RA   Briddon R.W.;
RT   ;
RL   Submitted (13-FEB-1995) to the EMBL/GenBank/DDBJ databases.
RL   R.W. Briddon, Dept. of Virus Research, John Innes Inst., Colney Lane,
RL   Norwich, NR4 7UH, UK
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2861
FT                   /db_xref="taxon:49267"
FT                   /mol_type="genomic DNA"
FT                   /organism="Tomato pseudo-curly top virus"
FT                   /clone="K77B-11"
FT                   /tissue_type="leaf"
FT                   /lab_host="Solanum nigrum"
FT   CDS             353. .1081
FT                   /db_xref="GOA:Q88886"
FT                   /db_xref="InterPro:IPR000143"
FT                   /db_xref="InterPro:IPR000263"
FT                   /db_xref="UniProt/TrEMBL:Q88886"
FT                   /gene="orf1"
FT                   /product="coat protein"
FT                   /protein_id="CAA59221.1"
FT                   /translation="MPYKRKLTSYFPQSKRFRGAKSGMAVVKTSASRRLYKKGKRKPDR
FT                   IKTYTYAFSSICTDKGTIVYMNSWSLGLGPQQRSSDIEILKSMYIRLTVALSENAASQV
FT                   KTYVVKWALIVDQVPGETLVGVADVYKTCPSPYPYVQCAYIADDNHSRFQVLRSGFLSL
FT                   SGNGLAVGSSTRTGCPAMKNMASINKFCKNLNVRCVYDADSATGDIASIKRGAVYLVIW
FT                   PDVEIRYGFSCTMYHRNGNA"
FT   CDS             193. .483
FT                   /db_xref="UniProt/TrEMBL:Q88887"
FT                   /gene="ORF V2"
FT                   /protein_id="CAA59222.1"
FT                   /translation="MATTNCRICGSSFACPINERFSVCESRGATLSDFLLYFRRKYIET
FT                   SPGLISYLNALQAEINELFSAIKEVSRSEIRHGSCEDKCQPSSIQKGKAEA"
FT   CDS             complement(1710. .2759)
FT                   /db_xref="GOA:Q88888"
FT                   /db_xref="HSSP:1L5I"
FT                   /db_xref="InterPro:IPR001191"
FT                   /db_xref="InterPro:IPR001301"
FT                   /db_xref="UniProt/TrEMBL:Q88888"
FT                   /gene="ORF C1"
FT                   /protein_id="CAA59223.1"
FT                   /translation="MPSNPKRFQIAAKNYFLTYPNCSLSKEEALDQLQRLQTPTNKKYI
FT                   KVARELHENGEPHLHVLIQFEGKFNCKNQRFFDLVSPTRSTHFHPNIQGAKSSSDVNSY
FT                   VDKDGDTIEWGEFQIDARSARGGQQTANDECAEALNRSSKEEALQIIKEKLPKDFLFCY
FT                   HNLVSNLDRIFTPAPTPFVPPFQLSSFTNVPEDMQEWADDYFGVSAAARPMRYKSIIIE
FT                   GESRTGKTMWARSLGPHNYLSGHLDFNSRVYSNSALYNVIDDVTPHYLKLKHWKELIGA
FT                   QRDWQSNCKYGKPVQIKGGIPSIVLCNPGGDTSFQDFLDKEENEALKDWTLYNAVFIKL
FT                   TEPLYDGTV"
FT   CDS             complement(1244. .1723)
FT                   /db_xref="GOA:Q88889"
FT                   /db_xref="InterPro:IPR000942"
FT                   /db_xref="UniProt/TrEMBL:Q88889"
FT                   /gene="ORF C2"
FT                   /protein_id="CAA59224.1"
FT                   /translation="MVLCDKGAHELGNREIRKGFCERCLYPEYFDDEEAATTTPTIKKR
FT                   PPKLTWAPKKKRRKAIHLSCGCSYYGGIDCEDGFTHRGITHVHTVPDWLLLRRHQEPNL
FT                   LPPPEHNNNGDGEQNNNITNQSQPQPAESVGSPDLLAELGGTFSITSSEWRSIIR"
FT   CDS             complement(1090. .1494)
FT                   /db_xref="InterPro:IPR000657"
FT                   /db_xref="UniProt/TrEMBL:Q88890"
FT                   /gene="ORF C3"
FT                   /protein_id="CAA59225.1"
FT                   /translation="MDSRTGELLTYTQCQTGCYFDDIKNPIYFRLQNTTTMATGNKIIT
FT                   LQIRANHNLRKVLGLQICWLNLVVLSVSPRLSGEALLDRFKFHVMKHLNNLGVISINNV
FT                   IRSINHFIDLFDQRVFYAPSFYYNIKMRLY"
FT   CDS             complement(2342. .2599)
FT                   /db_xref="InterPro:IPR002488"
FT                   /db_xref="UniProt/TrEMBL:Q88891"
FT                   /gene="ORF C4"
FT                   /protein_id="CAA59226.1"
FT                   /translation="MGNLISMCLYNSKGNSTAKINDSSTWYPQPGQHISIRTYRELNPA
FT                   PTSTPTSTRTETLSNGENSRLTLDLLEEASRQLTTNVQRP"
XX
SQ   Sequence 2861 BP; 727 A; 565 C; 626 G; 943 T; 0 other;

   X84735  Length: 2861  May 10, 2005 10:10  Type: N  Check: 7797  ..
       1  accggagtgc cctccctggc cctttaaaat gtgggtccca catgagggta
      51  ttgttgtcta ttcactctat caattcccgc tcaattattg ggcctctgtt
     101  cactaaggcc ttataaggcc cttaatgaat tgggccccaa gtttgtcttt
     151  atctgcagct ttatataaag ctgcagttgc tttcttaaag taatggccac
     201  cacaaattgt cggatttgtg ggtcctcttt tgcctgcccc attaacgaac
     251  gcttcagcgt ttgtgaatct cgaggagcta ctctgagtga ttttttgctg
     301  tattttcgta gaaaatacat agaaacttcc ccgggtttga tttcctatct
     351  caatgcctta caagcggaaa ttaacgagtt attttccgca atcaaagagg
     401  tttcgcggag cgaaatccgg catggcagtt gtgaagacaa gtgccagccg
     451  tcgtctatac aaaaagggaa agcggaagcc tgaccgtata aaaacatata
     501  cgtatgcatt ctctagtatt tgtactgata aaggtacaat tgtatatatg
     551  aacagctggt ctttgggttt gggtcctcaa cagcgtagca gtgacatcga
     601  gattttgaag tcgatgtata ttcgccttac tgttgctctg tctgaaaatg
     651  ctgcttctca agtgaagacc tatgtggtta aatgggctct aattgtggat
     701  caggttcctg gtgaaaccct agttggtgtg gcggatgtgt acaagacttg
     751  tccctctcct tatccttatg tgcagtgtgc ctatattgct gatgataatc
     801  acagtcgttt ccaagtgctg aggagtgggt ttcttagtct tagtggtaat
     851  ggtcttgcag ttggatcttc tactagaact ggatgtccgg cgatgaagaa
     901  tatggcctct attaacaaat tttgtaaaaa tttaaatgtt agatgcgttt
     951  atgacgcaga tagtgctact ggcgatatcg ccagtattaa gcgcggtgcc
    1001  gtttatcttg taatctggcc tgacgttgaa atccgttatg gattttcatg
    1051  tactatgtat catagaaatg gaaatgcgta atagagtgtt taatacaatc
    1101  tcatctttat attataataa aaacttggag cataaaatac acgctgatca
    1151  aataaatcaa tgaagtgatt tatcgatcta attacattat ttatactaat
    1201  aacacctaaa ttattcaaat gtttcattac atgaaattta aatctatcta
    1251  ataatgcttc tccactcaga cgaggtgata ctgaaagtac caccaagttc
    1301  agccaacaaa tctggagacc caacactttc cgcaggttgt ggttggctct
    1351  gatttgtaat gttattattt tgttccccgt cgccattgtt gttgtgttct
    1401  ggaggcggaa gtaaattggg ttcttgatgt cgtcgaagta acagccagtc
    1451  tggcactgtg tgtacgtgag taattcccct gtgcgtgaat ccatcctcac
    1501  agtctatgcc tccgtagtat gagcagccgc aggagaggtg aatggccttt
    1551  cgtctctttt tcttcggtgc ccaagtcagt ttggggggtc gttttttgat
    1601  agttggagtt gttgttgcag cttcttcgtc gtcaaagtat tctgggtata
    1651  agcacctttc gcagaaaccc ttccttatct ccctatttcc taattcgtgc
    1701  gcgcctttgt cacacagtac catcgtataa gggttcagtc agttttatga
    1751  atacagcatt atagagtgtc caatctttta aagcctcatt ctcttcctta
    1801  tcgaggaagt cttggaaaga ggtgtcccca ccagggttgc aaaggactat
    1851  tgatgggatg ccacctttaa tttgaactgg ctttccatat ttacagtttg
    1901  actgccagtc tctctgggcc ccaatcagct ctttccagtg ctttaacttt
    1951  aaatagtgcg gtgtgacgtc atcaatgacg ttatacaagg cactatttga
    2001  atacactctg ctgttaaaat ctaagtggcc ggataaataa ttatgtgggc
    2051  ccaagctcct agcccacatt gtcttgccgg tcctagactc accctcaatt
    2101  ataatacttt tatatctcat aggccgcgca gcggcactaa ctccaaaata
    2151  atcatccgcc cattcttgca tatcttcagg aacgttagta aatgaagata
    2201  attgaaacgg agggacaaac ggagttggtg ccggagtaaa aatcctatct
    2251  aagttagaaa ctaaattatg ataacaaaat aaaaaatctt taggcaattt
    2301  ttcttttata atttgtagag cttcctcttt tgaggaacgg tttagggcct
    2351  ctgcacattc gtcgttagct gtctgctggc ctcctctagc agatctagcg
    2401  tcaatctgga attctcccca ttcgatagtg tctccgtcct tgtcgacgta
    2451  ggagttgacg tcggagctgg atttagctcc ctgtatgttc ggatggaaat
    2501  gtgttgacct ggttggggat accaggtcga agaatcgttg atttttgcag
    2551  ttgaatttcc cttcgaattg tataagcaca tggagatgag gttccccatt
    2601  ttcgtgtagc tctctagcta cttttatgta ttttttattt gttggtgttt
    2651  gtagcctttg aagttggtcg agagcttctt ctttggataa agaacaattg
    2701  ggatatgtga ggaaatagtt cttggctgct atttgaaaac gtttgggatt
    2751  ggatggcata tttgtaaata tgtgttggtt accaattggt ttgcttttta
    2801  attctctaaa tgaatcggta actggtaccc aatttatagg ggagggcacc
    2851  gtattaatat t