!!NA_SEQUENCE 1.0
ID   LMV0PP     standard; mRNA; VRL; 10080 BP.
XX
AC   X97704;
XX
SV   X97704.2
XX
DT   14-MAY-1996 (Rel. 47, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 9)
XX
DE   Lettuce mosaic virus (strain O) mRNA for polyprotein
XX
KW   polyprotein.
XX
OS   Lettuce mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Potyvirus.
XX
RN   [1]
RX   DOI; 10.1016/S0168-1702(96)01411-6.
RX   MEDLINE; 97239892.
RX   PUBMED; 9085548.
RA   Revers F., Yang S.J., Walter J., Souche S., Lot H., Le Gall O.,
RA   Candresse T., Dunez J.;
RT   "Comparison of the complete nucleotide sequences of two isolates of lettuce
RT   mosaic virus differing in their biological properties";
RL   Virus Res. 47(2):167-177(1997).
XX
RN   [2]
RP   1-10080
RA   Le Gall O.J.J.;
RT   ;
RL   Submitted (09-MAY-1996) to the EMBL/GenBank/DDBJ databases.
RL   O.J.J. Le Gall, INRA, Station de Pathologie Vegetale, BP 81, 33883
RL   Villenave dOrnon Cedex, France
XX
RN   [3]
RA   Le Gall O.J.J.;
RT   ;
RL   Submitted (18-AUG-2000) to the EMBL/GenBank/DDBJ databases.
RL   O.J.J. Le Gall, INRA, Station de Pathologie Vegetale, BP 81, 33883
RL   Villenave dOrnon Cedex, France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .10080
FT                   /db_xref="taxon:12202"
FT                   /mol_type="mRNA"
FT                   /organism="Lettuce mosaic virus"
FT                   /lab_host="Lactuca sativa"
FT                   /strain="0"
FT   CDS             104. .9871
FT                   /db_xref="GOA:P31999"
FT                   /db_xref="HSSP:1LVM"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001456"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR002540"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/Swiss-Prot:P31999"
FT                   /product="polyprotein"
FT                   /protein_id="CAA66280.2"
FT                   /translation="MATLDNCTQVHHMFAYNREHGTNYTRNHFRRYLAAQRIGFYYDWD
FT                   DDVYECPTCEAIYHSLDDIKNWHECDPPAFDLNDFITDARLKSAPVPDLGPVIIEIPKA
FT                   EEKQELNFFAATPAPEVSQWKCRGLQFGSFTELETSEPVASAPEPKCEEPARTIAKPEE
FT                   SVEQETRGDGKRLLQAQMEVDKAEQDLAFACLNASLKPRLEGRTTATIARRRDGCLVYK
FT                   TKPSWSQRRRAKKTLKVDTLACENPYIPAIVDKISIAGGSSASVMHEQQKPKTLHTTPS
FT                   RKVATHYKRTVMNQQTLMAFINQVGTILLNAEKEFEVVGCRKQKVTGKGTRHNGVRLVK
FT                   LKTAHEEGHRRRVDIRIPNGLRPIVMRISARGGWHRTWTDSELSPGSSGYVLNSSKIIG
FT                   KFGLRRHSIFVVRGRVDGEVIDSQSKVTHSITHRMVQYSDVARNFWNGYSTCFMHNTPK
FT                   DILHTCTSDFDVKECGTVAALLTQTLFQFGKITCEKCAIEYKNLTRDELATRVNKEIDG
FT                   TIISIQTQHPRFVHVLNFLRLIKQVLNAKNGNFGAFQETERIIGDRMDAPFSHVNKLNA
FT                   IVIKGNQATSDEMAQASNHVLEIARYLKNRTENIQKGSLKSFRNKISGKAHLNPSLMCD
FT                   NQLDKNGGFEWGQRSYHAKRFFDGYFETIDPSDGYSKYTIRRNPNGHRKLAIGNLIVST
FT                   NFESHRRSMIGESIEDPGLTNQCVSKEGDTFIYPCCCVTDEYGKPTLSEIKMPTKHHLV
FT                   LGNAGDPKYVDLPKEAEGKMFVTKDGYCYINIFLAMLVDVPEDQAKDFTKMAREIAVKQ
FT                   LGEWPSMMDVATACNILATFHPDTRRSELPRILVDHATKTFHVIDSYGSITTGFHILKA
FT                   NTVTQLVKFAHESLESEMQHYRVGGEPDKAPRKPAGSVPTLGISDLRDLGVELENEEHS
FT                   IRPNLQRLIKAIYRPRMMRSLLTEEPYLLILSIVSPGVLMALYNSGSLERTMHEFLQTD
FT                   QRLSATAQILKHLAKKVSLAKTLTIQNAILEGGAGSLNEILDAPAGRSLSYRLAKQTVE
FT                   VMMARSDMDKELVDVGFSVLRDQKNELIEKSYLMDLEDSWHALPLCGKLSAMRASRRWR
FT                   DTSTPEVIPTGAADLKGRYSISVGSVSKSAILHLKGICSGAVKRVRDKWVGVQVQGVKW
FT                   LAKSVHYMIPELTNILNVGTLLLTLISLGVAFRNLTGQFKEMKHKETLAKEEELRKRIR
FT                   TYNSTYYEIHGKHADAKQITKFITHHDPKLLEVVEFYEGPEEEEVEHQAKREDQANLER
FT                   IIAFTALVMMMFDSERSDCVYRSLSKLKSLVSTCEDDVRHQSVDEIIDLFDEKKETIDF
FT                   EIEGKELYSSRVVDSTFSKWWDNQLVRGNTMAHYRTEGHFMTFTRETAASVAAEIAHNE
FT                   YRDILLQGGVGSGKSTGLPFHLHRKGGVLLIEPTRPLAQNVYKQLGSSPFHLSPNLRMR
FT                   GSCKFGSSQVTVATSGYALHFIANNAQSLKAYDFIIFDECHVLDASAMAFRCLLQEFEY
FT                   QGKIIKVSATPPGRKLDFKPMHMVDIATENELSIQQFVQGQGTGVNCDATKKGDNILVY
FT                   VSSYNEVDMLSKMLNDKGYKVTKVDGRTMKLGSVEVETVGTPQRKHFVVATNIIENGVT
FT                   LDVDVVVDFGQKVVPILDSEHRMIRYTKKSITYGERIQRVGRVGRNKAGSAIRIGSTEM
FT                   GTEEIPASIATEAAFLCFTYGLPVMTSNVSTSVLGNCTVRQARTMQKFELSPFFMVDLV
FT                   HHDGTIHPAINSLLKQFKLKESDIKLSTLAIPNAVTTFWKSAREYNSLGARTTIDDAAK
FT                   IPFMIKDVPEHLQEKLWETIQQYKGDAGFGRCTSANACKIAYTLSVSPFMIPATINKID
FT                   ALMAEERQKMEYFQTVTANTCTISNFSISSIGDMIRSRYSTNHSRENLQKLQAVRDTII
FT                   NFECQAGTGDGGSFDMETAQKLAEEYGCIDVIYHQSKEALSKRLGLKGRWNQSLICKDL
FT                   LVFCGVAIGGTWMMFQSFKDGMADAVRHQGKGKRQRQKLRYRQARDNKVGIEVYGDDAT
FT                   MEHYFGAAYTEKGKKSGKTKGMGTKNRRFVNMYGYNPEDFSFIRFLDPLTGKTMDEQVF
FT                   SDISLVQDAFSKERLKLLSEGEIESEHMRNGIRAYLVKNLTTAALEIDMTPHNSCQLGA
FT                   KTNNIAGYVDREYELRQTGEARVVAPALIPKDNPITDEDIPVKHESKTLFRGLRDYNPI
FT                   AAAICLLTNESDGMKETMYGIGFGNTIITNQHLFRRNNGVLRVQSRHGEYVLPNTTQLK
FT                   VLPCEGRDIMVIILTPDFPPFPQKLKFRPPIKGEKICLVGSLFQDKSITSTVSETSVTT
FT                   PVDNSFLWKHWITTKDGHCGLPLVSSNDGYIVGIHSATSSRQTQNYHAAMPEDFHQTHL
FT                   IDPASKSWVKHWKYNPDNMVWGGINLINSTPREPFKINKLVTDLFGDAVQFQSKQDEWF
FT                   ASQLKGNLKAVGKSTSQLVTKHTVKGKCMMFELYLQTHEEEKEFFKPLMGAYQKSRLNR
FT                   EAFTKDIMKYSTPITVGIVDCDTFLKAEEGVIKRLERLGFSGCEYVTDEEAIFQALNMK
FT                   AAVGALYSGKKRDYFEGYGPEEKENILRESCKRLYTGKFGVWNGSLKSELRPMEKVMAN
FT                   KTRVFTAAPLDTLLAGKVCVDDFNNYFYSKNIEAPWTVGMTKFYGGWNELLTKLPDGWV
FT                   YCDADGSQFDSSLSPFLINSVLRIRLKFMEDWDLGEQMLKNLYTEIVYTAILTPDSTIV
FT                   KKFKGNNSGQPSTVVDNTLMVVLAMTYTLHKLGFEDEEQDSMCKYFVNGDDLIIAIKPE
FT                   HESLLDQFQHCFKSLGLNYDFNSRTRKKEELWFMSHCGIKKDGIFIPKLEPERIVSILE
FT                   WDRSDQPVHRLEAICAAMIESWGYDKLTHEIRKFYKWCLEQAPYADLAKAGKAPYIAEC
FT                   ALKRLYTSKEASEAELEKYMEAIRSLVNDEDDDDMDEVYHQVDAKLDAGQGSKTDDKQK
FT                   NSADPKDNIITEKGSGSGQMKKDDDINAGLHGKHTIPRTKAITQKMKLPMIRGKVALNL
FT                   DHLLEYEPNQRDISNTRATQKQYESWYDGVKNDYDVDDSGMQLILNGLMVWCIENGTSP
FT                   NINGTWVMMDGEEQVEYALKPIIEHAKPTFRQIMAHFSDAAEAYIEMRNKKKPYMPRYG
FT                   RLRGLNDMGLARYAFDFYETTSATPNRAREAHNQMKAAALVGTQNRLFGMDGGGSTQEE
FT                   NTERHTAADVNQNMHTLLGVRGLH"
XX
SQ   Sequence 10080 BP; 3298 A; 2128 C; 2400 G; 2254 T; 0 other;

  X97704  Length: 10080  May 10, 2005 10:10  Type: N  Check: 9578  ..
       1  aaaataaaac aacccaacac aactcaagaa aattcataca aacaaacaaa
      51  ttcgcatttt caagcaattc actttcaagc attcacaaca ttttcaacca
     101  caaatggcaa ctctagacaa ctgcactcaa gtacaccaca tgttcgctta
     151  caatcgcgaa cacggaacaa actacacgag gaaccatttc agaagatact
     201  tagcagccca gcggataggc ttctattatg attgggacga tgatgtctat
     251  gaatgtccaa cgtgtgaagc tatataccat tctttggacg acataaagaa
     301  ctggcacgag tgcgacccac cagcattcga ccttaacgat ttcataactg
     351  atgctaggct gaaatcagca ccagttccag atctcggacc ggtgatcatt
     401  gagatcccaa aagcggagga aaaacaagag cttaacttct tcgctgcaac
     451  cccggcacct gaagtgtcac aatggaaatg cagagggttg caatttggtt
     501  catttactga acttgaaaca tctgaaccag ttgcctcggc accagagcct
     551  aagtgtgaag agccggctag gaccatcgca aagccagagg agtcagtcga
     601  acaagagacc cgtggagatg gaaaaagact ccttcaggcg cagatggaag
     651  tcgacaaagc cgaacaagat cttgcattcg cttgcctgaa cgctagccta
     701  aaacctaggt tggagggcag aactactgca actattgcaa ggcgcaggga
     751  cggatgtttg gtttataaaa ccaaaccaag ctggtcgcag aggaggagag
     801  caaagaagac ccttaaggtt gacaccctag cttgcgaaaa cccatacatt
     851  ccagcaattg ttgacaagat ctcaattgca ggaggctcat cagctagtgt
     901  gatgcatgaa caacagaaac ctaaaactct gcacactaca ccatcaagaa
     951  aggtggccac gcattataaa cggacggtga tgaaccaaca gacactcatg
    1001  gcctttataa atcaagttgg cacgattcta ctaaacgcag agaaagagtt
    1051  tgaagtggta ggctgcagaa aacaaaaagt aactggcaag ggaactagac
    1101  ataatggtgt gaggctggta aagcttaaaa ctgcacatga ggaaggacat
    1151  cggagaagag tagatatacg catccccaat ggcctgcgcc caattgttat
    1201  gcgtatttca gctagaggcg gttggcacag aacatggaca gactcagaac
    1251  tatccccagg atcaagcggt tacgtattga actcgtcaaa aatcatagga
    1301  aaatttggtt taaggcgaca cagtatattc gttgttaggg gtagggtaga
    1351  tggtgaagtt atagattcgc aaagtaaggt cacacactcc atcacgcacc
    1401  gtatggttca atacagcgac gtcgcacgaa acttctggaa cggatactca
    1451  acttgtttca tgcacaacac cccaaaggac atactccata cctgcacatc
    1501  agattttgat gttaaagaat gtggcactgt cgcagcactt ttaactcaaa
    1551  cactgtttca atttgggaaa atcacctgtg aaaaatgcgc aatcgagtac
    1601  aaaaatctaa cgcgagatga gcttgccacg cgtgttaata aggagattga
    1651  tggaaccata atcagtattc aaactcagca tccacgcttc gtgcatgtac
    1701  tcaattttct caggttaatt aaacaagtgc tcaatgctaa gaatgggaac
    1751  tttggagcat ttcaagagac ggagaggata attggggatc gaatggatgc
    1801  acctttctca cacgtaaata agttgaatgc tatcgtcatt aaaggtaatc
    1851  aagcaacgtc tgatgagatg gcacaagcat cgaaccatgt cctcgaaatc
    1901  gcgcgatatc tcaaaaaccg gactgagaac atccaaaagg gctcactaaa
    1951  gtcattcagg aacaagatct ccggtaaggc acacttaaat ccgagcctta
    2001  tgtgtgacaa tcaacttgat aagaacggcg ggtttgaatg ggggcaacga
    2051  agttaccatg ccaaaaggtt tttcgacggg tactttgaaa ccatcgaccc
    2101  atccgatggc tatagcaaat acaccataag acgcaatcca aatggacatc
    2151  gaaagttggc aattggtaat ttgatcgtct ctacgaactt tgaatcacat
    2201  agaagaagca tgattggaga atcgattgaa gaccctggtc tcactaacca
    2251  gtgcgtgagc aaagagggag atactttcat atatccatgc tgctgtgtaa
    2301  cagatgaata tggtaaacca acattatctg agattaaaat gcccacaaag
    2351  catcatctag tcctaggaaa tgccggtgac cccaaatatg tggatttacc
    2401  aaaggaagcg gaaggaaaga tgttcgtaac aaaagacgga tattgttaca
    2451  taaacatctt cttggctatg cttgtcgacg tcccagagga tcaagctaaa
    2501  gatttcacga agatggcacg cgagatagca gtgaaacagc tcggggagtg
    2551  gccctcaatg atggatgtgg cgacggcttg taatatatta gctacatttc
    2601  atccagacac ccgaagatcg gagttacctc gaatcttagt cgatcacgca
    2651  acgaaaacat tccatgtaat tgactcatat ggttcaatca cgactggatt
    2701  ccatattctg aaagccaaca ccgtgacaca actcgtcaag ttcgcgcatg
    2751  agtcactaga atctgagatg caacactaca gagtaggggg ggaaccagat
    2801  aaagcaccca ggaaaccagc tggtagtgtc ccaactctag gaatttcaga
    2851  cctcagggac cttggagtgg aattagaaaa cgaagagcac tcaatccggc
    2901  caaatctcca aaggttgatc aaggcgattt atagaccccg aatgatgcgc
    2951  agcctcttaa cagaggaacc atacttgtta atcctaagta ttgtgtcccc
    3001  tggcgttctg atggcactct acaacagtgg ttccttggag cggacaatgc
    3051  atgagttctt gcaaactgat cagagactga gcgccaccgc ccaaatccta
    3101  aaacatctag caaagaaagt ttcactcgca aagacactta caatccagaa
    3151  tgctatcttg gagggtggag caggatcact gaatgagatt cttgacgcgc
    3201  ctgcgggacg atccttatcg tacagactgg caaagcagac ggtggaggtt
    3251  atgatggccc ggagcgacat ggataaggaa ctggtggacg ttggatttag
    3301  cgttcttagg gaccagaaga atgaactcat agaaaaaagt tatctcatgg
    3351  atttggagga ttcgtggcac gcactaccat tgtgtggaaa attatcagca
    3401  atgcgagcct cgcggcgatg gcgggatact tctactccag aagtaatccc
    3451  aacaggcgcc gcagatttga aaggcagata cagtatctcg gttggatctg
    3501  tttccaaaag cgcgatcttg cacctaaagg gaatttgctc aggcgcagta
    3551  aagagagtta gagacaagtg ggtcggagtg caagtgcaag gcgtaaaatg
    3601  gttagctaaa tcagtgcact acatgatacc agaactaacg aacatattga
    3651  acgttggaac tctcctccta acactgatat cgctaggcgt agcattccgg
    3701  aacctgactg gccagtttaa agagatgaag cataaagaga cgctggcaaa
    3751  ggaggaggaa ctacgtaagc gcatacgcac ctacaatagc acttattacg
    3801  aaatccacgg aaagcacgct gatgccaaac aaatcactaa gttcataaca
    3851  caccatgatc caaaactact agaagtagtt gaattttacg aaggtcctga
    3901  agaagaagaa gtagagcatc aagcaaagcg agaggatcaa gctaatctcg
    3951  aacgcattat cgctttcaca gctttggtga tgatgatgtt tgacagcgag
    4001  agaagtgatt gcgtgtacag gagtttatca aagctcaaat cattagtatc
    4051  tacgtgcgag gatgatgtac gccatcagag cgttgacgag atcattgacc
    4101  tatttgatga gaagaaagaa actatagatt tcgagattga aggaaaagaa
    4151  ctttactctt ctcgcgtggt ggattcgaca ttcagtaagt ggtgggacaa
    4201  ccaattggta cgaggcaaca cgatggcaca ctacagaaca gaggggcact
    4251  tcatgacgtt cactcgtgaa acagctgcga gcgtggcagc cgaaatagca
    4301  cataacgagt atagagatat cctcttgcaa ggtggtgtcg gctccggtaa
    4351  gtccacaggc ctcccatttc atttacacag gaaaggaggt gtgctactca
    4401  tcgaaccaac tcgtccgtta gctcaaaacg tatacaagca gcttggaagt
    4451  agtccttttc acctgtcacc aaatttgcgc atgcgaggtt cttgcaagtt
    4501  tggatctagt caggtaactg tggccacgag tggttatgcc ttacatttca
    4551  tagcgaacaa tgcgcaaagt cttaaggcat atgactttat cattttcgat
    4601  gaatgtcacg tattagacgc cagtgcaatg gcgtttagat gcttgctgca
    4651  ggagttcgag tatcaaggga agatcataaa ggtatcagct acgccaccgg
    4701  gaaggaagct tgacttcaaa ccaatgcaca tggtcgatat tgctacagaa
    4751  aatgaactat cgatacagca attcgtccaa ggtcaaggaa ctggagtgaa
    4801  ctgtgatgca acaaagaaag gagacaacat cttggtctac gtctcaagtt
    4851  acaacgaagt agacatgttg agcaaaatgt taaacgacaa aggttacaaa
    4901  gtgacaaagg ttgatggtag gacgatgaag ttagggagtg tggaagtaga
    4951  aacagtaggc accccgcagc ggaaacactt tgtagtggca accaacatca
    5001  tagaaaatgg cgttacactg gatgtcgatg ttgtggtgga tttcggacag
    5051  aaggtagtcc ccattcttga tagcgagcac cgaatgattc ggtatacaaa
    5101  gaaaagtatt acatatggtg agcgcatcca aagagtggga agggttgggc
    5151  gaaacaaagc tggttctgcc atccggatag gaagcactga gatggggacg
    5201  gaagaaatac cagcatcaat cgcaacagaa gcagcctttt tgtgtttcac
    5251  atacggactt cctgtcatga caagcaacgt gagcacaagt gtacttggca
    5301  attgcacagt aagacaagca cggacgatgc aaaagtttga gctgtccccc
    5351  ttctttatgg ttgacttggt acaccacgac ggtacaatac acccagcaat
    5401  taacagcctc ctgaaacagt tcaagttgaa ggaatcagac atcaaactaa
    5451  gcacgctggc aataccgaat gcagtgacca cattctggaa aagcgctcga
    5501  gagtacaact ccttaggtgc ccgcacaaca attgatgacg cagctaaaat
    5551  accatttatg atcaaggacg ttccagaaca cttgcaggaa aagctttggg
    5601  agacaatcca gcagtataag ggtgatgcgg gttttgggag atgtacatca
    5651  gctaatgcgt gcaaaatagc atacacactc tctgtgagtc ccttcatgat
    5701  cccagcaaca atcaacaaga ttgatgccct gatggccgaa gaacgacaaa
    5751  agatggaata cttccaaaca gtcacagcta acacatgtac aatctcaaac
    5801  ttctccatta gtagtattgg tgacatgatc aggtcgagat actcaacaaa
    5851  ccattctaga gagaacctgc aaaaactaca agcagtcaga gacacaatca
    5901  tcaacttcga gtgccaggct ggaactggtg acgggggttc cttcgacatg
    5951  gagacagcac agaaattggc agaggagtat gggtgcatcg atgtcattta
    6001  tcaccaatcg aaagaagctc tcagtaaacg actcggtctc aaaggcagat
    6051  ggaatcagag cctgatatgc aaagatttat tggttttctg cggcgtagcc
    6101  attggcggca catggatgat gtttcagagc ttcaaggacg ggatggctga
    6151  tgcagttcga caccaaggca aaggtaaacg gcaaagacag aagctccgtt
    6201  atcgacaagc aagggacaac aaggtaggca ttgaagttta tggtgacgat
    6251  gcgacgatgg aacactattt tggagctgcg tatacggaga aagggaagaa
    6301  atccggaaaa acgaaaggaa tgggaacgaa aaatcgaaga tttgtaaata
    6351  tgtatggata caacccagaa gatttctcat tcatccgatt tctggacccg
    6401  ctcacaggga aaacaatgga cgaacaagta ttttctgaca taagtctcgt
    6451  ccaagatgcc tttagtaagg aaagactcaa actcctatcc gaaggagaaa
    6501  tcgaatcgga gcacatgcga aacggaatta gagcttatct tgtcaagaat
    6551  cttaccacag cagcactcga gatagacatg acccctcaca actcttgcca
    6601  gctcggagcc aagacaaaca acatagcagg atatgtcgac agagaatatg
    6651  aattgcgtca gactggagaa gctagggttg ttgctccagc actgatccca
    6701  aaggacaatc caattacgga cgaagacatc cctgtaaagc acgaaagcaa
    6751  aacactgttc aggggcttaa gagattacaa ccctatagca gcagcaatat
    6801  gcttgcttac caacgaatcg gatggaatga aagagacaat gtatggcatt
    6851  ggttttggta acacaattat tacaaaccaa cacctattca ggcgcaacaa
    6901  tggcgtattg agggttcaat cgagacatgg tgaatacgtg cttccgaata
    6951  caacgcagct caaagtactt ccttgtgaag gaagggacat aatggttatc
    7001  attctcacac cagacttccc tccgtttcca caaaagctga aattccgtcc
    7051  accgatcaaa ggagagaaga tttgcctcgt tggatcctta ttccaggata
    7101  agagcatcac cagcaccgta tctgagacga gcgtgacaac accagtggac
    7151  aacagcttct tgtggaaaca ctggatcact acaaaagatg gccattgcgg
    7201  acttccacta gtatcatcaa atgatggata catagtcgga atccacagtg
    7251  ctacgagttc acgacaaaca cagaactatc atgcagcgat gcccgaagat
    7301  tttcatcaaa cacatcttat agatccagct tcaaaatcgt gggtgaaaca
    7351  ttggaaatac aatccagata acatggtttg ggggggcata aatctcatca
    7401  atagtacccc aagagaaccc ttcaaaataa acaaattagt gacagactta
    7451  ttcggagacg cagtacagtt tcaatccaaa caagacgaat ggtttgcaag
    7501  tcaattgaaa ggcaacttga aagcagtggg gaagagcaca agccaactcg
    7551  taacaaagca cacagtcaag ggtaagtgca tgatgtttga gctatacctg
    7601  caaacacacg aagaggaaaa ggagttcttc aaaccactga tgggagccta
    7651  ccagaagagc cgcttgaaca gagaagcatt cacaaaagac atcatgaaat
    7701  actccacacc gataacagtg ggcatcgtcg attgcgacac gtttttgaaa
    7751  gccgaagaag gagtcataaa acgcttagag agacttggat tcagtggttg
    7801  cgaatacgtt acagatgaag aggcaatctt tcaagccctg aatatgaaag
    7851  cggctgttgg tgcactatat agtggaaaga agagggatta cttcgagggc
    7901  tacggtccag aagaaaaaga gaatatcttg agagaaagct gcaaacgact
    7951  atatacaggt aagtttggag tttggaatgg gtcactcaag tcggaactga
    8001  gacctatgga aaaagtcatg gccaataaga cacgtgtctt tacggcagcg
    8051  ccgctcgaca ctctgcttgc tggaaaagtc tgcgttgatg actttaacaa
    8101  ctacttctac agcaaaaaca tcgaagcacc ttggacagtt ggtatgacga
    8151  agttttatgg tggttggaat gagctcctca cgaagttacc agatggctgg
    8201  gtttattgcg atgcagatgg atcacaattt gatagttctt tgtcaccatt
    8251  tctcatcaac tcagtgctca gaatacgttt aaaattcatg gaggattggg
    8301  atcttggtga acagatgctc aaaaatctgt acacagaaat tgtatacaca
    8351  gcgatcctca ctccagattc aaccatagtg aagaagttca agggaaataa
    8401  cagcggacag ccatccacgg tagtagacaa cacattgatg gttgtgttgg
    8451  ctatgacata cacgctgcac aagttaggct ttgaagatga ggaacaagac
    8501  tctatgtgca agtacttcgt caatggagac gacctgatca tcgcgataaa
    8551  accagaacac gaatcattac tggatcagtt ccaacattgt ttcaaaagtt
    8601  tgggcctaaa ttacgatttc aactcacgaa cgaggaagaa ggaagaattg
    8651  tggttcatgt cacattgcgg catcaagaaa gacggaattt tcattccaaa
    8701  actcgaacca gagcgcattg tgtcaatcct agagtgggat aggtcagacc
    8751  agccagtgca tcgcttagag gccatatgtg cagcaatgat cgaatcatgg
    8801  ggttacgaca aattaaccca tgaaattcga aaattctaca agtggtgcct
    8851  ggaacaagca ccatatgctg atttggcgaa agcgggaaaa gcaccgtaca
    8901  tagcagagtg tgctcttaaa cgattataca ccagcaagga agccagcgaa
    8951  gcggagttag aaaaatacat ggaagctata cgcagtcttg tcaatgatga
    9001  agatgacgat gatatggatg aggtctatca tcaagtagac gcaaagcttg
    9051  atgcaggcca aggcagtaaa actgatgata agcaaaagaa ctcagcggat
    9101  ccaaaggata atatcatcac agagaaagga agtggttctg ggcagatgaa
    9151  gaaggatgac gacatcaacg cagggctaca tggtaaacac accatacctc
    9201  gtacaaaggc aatcacacag aaaatgaagt taccaatgat ccgaggtaaa
    9251  gtggctttaa accttgatca tttgctggag tacgaaccaa accagagaga
    9301  catatcgaac acacgtgcaa cccagaaaca gtacgagtca tggtacgacg
    9351  gggttaagaa tgactacgat gtggatgata gtggcatgca attaattctg
    9401  aacggattga tggtttggtg tatagaaaac gggacatccc cgaatataaa
    9451  tggaacatgg gtgatgatgg atggtgaaga acaagtagaa tatgctctaa
    9501  aacccatcat cgaacacgcg aaacccacgt ttcgccagat aatggcccac
    9551  ttcagtgacg cagccgaggc gtacattgag atgagaaaca agaagaaacc
    9601  gtatatgcca cgatacggac ggctacgagg cttgaacgat atggggctag
    9651  ctcgctatgc tttcgacttc tacgaaacaa catcagcgac cccaaatcgg
    9701  gcaagagagg cgcacaatca aatgaaggca gctgctctag tgggaacaca
    9751  gaacagactg tttggaatgg atggaggcgg ttcaacccag gaagagaaca
    9801  cggagaggca cacagccgca gatgtaaatc agaatatgca tactctctta
    9851  ggcgtgagag ggttgcacta aaggcgtgtg ttggcattta aagactgtag
    9901  tataaatcta taatatagtg agtgtttcac tccttttatg tttatgtatg
    9951  cacttatttg tccgttagta ttctctccct gtacttcgct cgtgagggcg
   10001  taggttcagc tgagggcttt tctagtttcc gctgtgaggt tttacctcga
   10051  aggttgctag tctggttttc agtcggagac