!!NA_SEQUENCE 1.0
ID   LMVEPP     standard; genomic RNA; VRL; 10080 BP.
XX
AC   X97705;
XX
SV   X97705.1
XX
DT   14-MAY-1996 (Rel. 47, Created)
DT   14-JUN-2005 (Rel. 84, Last updated, Version 9)
XX
DE   Lettuce mosaic virus (strain E) mRNA for polyprotein
XX
KW   polyprotein.
XX
OS   Lettuce mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Potyvirus.
XX
RN   [1]
RX   DOI; 10.1016/S0168-1702(96)01411-6.
RX   PUBMED; 9085548.
RA   Revers F., Yang S.J., Walter J., Souche S., Lot H., Le Gall O.,
RA   Candresse T., Dunez J.;
RT   "Comparison of the complete nucleotide sequences of two isolates of lettuce
RT   mosaic virus differing in their biological properties";
RL   Virus Res. 47(2):167-177(1997).
XX
RN   [2]
RP   1-10080
RA   Le Gall O.J.J.;
RT   ;
RL   Submitted (09-MAY-1996) to the EMBL/GenBank/DDBJ databases.
RL   O.J.J. Le Gall, INRA, Station de Pathologie Vegetale, BP 81, 33883
RL   Villenave dOrnon Cedex, France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .10080
FT                   /db_xref="taxon:12202"
FT                   /mol_type="genomic RNA"
FT                   /organism="Lettuce mosaic virus"
FT                   /lab_host="Lactuca sativa"
FT                   /strain="E"
FT   CDS             104. .9871
FT                   /db_xref="GOA:P89876"
FT                   /db_xref="HSSP:1LVM"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001456"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR002540"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="UniProt/Swiss-Prot:P89876"
FT                   /product="polyprotein"
FT                   /protein_id="CAA66281.1"
FT                   /translation="MATLDNCTQVHHMFAYNREHGTNYTRNHFRRYLAAQRIGFYYDWD
FT                   DDVYECPTCEAIYHSLDEIKNWHECDPPAFDLNDFITDARLKSAPVPDLGPVIVETPKV
FT                   EEKQELNFFAATPAPEVLQWKCRGLQFGSFTELETSEPVVSAPKPNCEEPARTIAKPEE
FT                   PVEQETCGDGKRLLQAQMEVDKAEQDLAFAYLSASLKPRLEGRTTATIARRRDGCLVYK
FT                   TKPSWSQRKGTKKILKVDTLACKNPYIPAVVDKISIAGGSSASVMHEQQKPKILHTTPS
FT                   RKVATHYKRTVMNQQTLTALINQVGTIILNAEKEFEVVGCRKQKVTGKGTRHNGVRLVK
FT                   LKTAHEEGHRRKVDIRIPNGLRSIVTRISARGGWHKTWTDSELSPGSSGYVLNSSKIIG
FT                   EFGLRRHSIFVVRGRVYGKIIDSQSKVTHTLTHRMVQYSDVARNFWNGYSTCFMHNTPK
FT                   DILHTCTSDFDVKDCGTVAALLTQTLFQFGKITCGKCAIEYKNLTRDELATRVNKEIDG
FT                   TIISIQTQHPRFVHVLNFLRLIKQVLNAKNGNFGAFQETERIIGDRMDAPFSHVNKLNA
FT                   IVIKGNQATSDEMAQASNHVLEIARYFKNRTENIQKGSLKSFRNKISGKAHLNPSLMCD
FT                   NQLDKNGGFEWGQRSYHAKRFFDGYFETIDPSDGYSKYTIRRNPNGHRKLAIGNLIVST
FT                   NFESHRRSMVGEPIEDPGLTNQCVSKEGGAFIYPCCCVTDEYGKPTLSEIKMPTKHHLV
FT                   LGNAGDPKYVDLPKEAEGKMFVAKDGYCYINIFLAMLVDVPEDQAKDFTKMAREIAVKQ
FT                   LGEWPSMMDVATACNILATFHPDTRRSELPRILVDHATKTFHVIDSYGSITTGYHILKA
FT                   NTVTQLVKFAHESLESEMQHYRVGGEPDKAPRKPAGNVPTLGISDLKNLGVESENEEHS
FT                   IRPNLQRLIKAIYRPRMMRSLLTEEPYLLILSIVSPGVLMALYNSGSLERTMHEFLQTD
FT                   QRLSATAQILKHLAKKVSLAKTLTIQNAILEGGAGSLNEILDAPAGRSLSYRLAKQTVE
FT                   VMMARSDMDKELVDVGFSVLRDQKNELIEKSYLMDLEDSWRALPLCGKLSAMRVSRRWR
FT                   DTSTPEAIPTGAADLKGRYSISVGSVSKSAILHLKGICSGAVKRVKDKWVGVQVQGVKW
FT                   LAKSVHYMIPELTNILNVGTLLLTLISLGVRFRSLTGQFKEMKYKETLAREEELRKRIR
FT                   TYNSTYYEIHGKHADAKQITKFITHHDPKLLEVVEFYEGPEEEEVEHQAKREDQANLER
FT                   IIAFTALVMMMFDSERSDCVYRSLSKLKSLVSTCDDDVRHQSVDEIIDLFDEKKETIDF
FT                   EIEGKELYSSRVVDSTFSKWWDNQLVRGNTMAHYRTEGHFMTFTRETAASVAAEIAHNE
FT                   YRDILLQGGVGSGKSTGLPFHLHKKGGVLLIEPTRPLAQNVYKQLGSNPFHLSPNLRMR
FT                   GACKFGSSQVTVATSGYALHFIANNAQSLKMFDFIIFDECHVLDASAMAFRCLLQEFEY
FT                   QGKIIKVSATPPGRKLDFKPMHMVDITTENELSIQQFVQGQGTGVNCDATKKGDNILVY
FT                   VSSYNEVDMLSKMLNDKGYKVTKVDGRTMKLGSVEVETVGTPQRKHFVVATNIIENGVT
FT                   LDVDVVVDFGQKVVPILDSEHRMIRYTKKSITYGERIQRVGRVGRNKAGSAIRIGSTEM
FT                   GTEEIPASIATEAAFLCFTYGLPVMTSNVSTSVLGNCTVRQARTMQKFELSPFFMVDLV
FT                   HHDGTVHPAINSLLRQFKLKESDTKLSTLAIPNAVTTFWKSAREYNSLGARTTIDDAAK
FT                   IPFMIKDVPEHLQEKLWETIQQYKGDAGFGRCTSANACKIAYTLSVSPFMIPATINKID
FT                   ALMAEERQKLEYFQTVTANTCTISNFSISSLGDMIRSRYSTNHSRENLQKLQTVRDTII
FT                   NFECQAGTSDGGTFDMETAQKLAEEYGCIDVIYHQSKGALSKRLGLKGRWNQSLICKDL
FT                   LIFCGVAIGGTWMMFQSFKDGMADVIRHQGKGKRQRQKLRYRQARDNKMGIEVYGDDAT
FT                   MEHYFGAAYTEKGKKSGKTKGMGTKNRRFVNMYGYNPEDYSFIRFLDPLTGKTMDEQVF
FT                   TDISLVQDAFGKERLKLLSEGEIESEHMRNGIRAYLVKNLTTAALEIDMTPHNSCQLGT
FT                   KTNNIAGFVDREYELRQTGEARVVAPALIPKDNPITDEDIPVKHESKTLFRGLRDYNPI
FT                   ASAICLLTNESDGMKETMYGIGFGNTIITNQHLFRRNNGVLRVQSRHGEYVLPNTTQLK
FT                   VLPCEGRDIMVIILTPDFPPFPQKLKFRPPIKGEKICLVGSLFQDKSITSTVSETSVTT
FT                   PVDNSFLWKHWITTKDGHCGLPLVSSNDGYIVGIHSATSSRQTQNYHAAMPEDFHQTHL
FT                   IDPVSKSWVKHWKYNPDNMVWGGINLINSTPREPFKINKLVTDLFGDAVQFQSKQDEWF
FT                   ASQLKGNLKAVGKSTSQLVTKHTVKGKCMMFELYLQTHEEEKEFFKPLMGAYQKSRLNR
FT                   EAFTKDIMKYSTPITVGIVDCDTFLKAEKGVIKRLEKLGFSGCEYVTDEEAIFQALNMK
FT                   AAVGALYSGKKRDYFESYGPEEKENILRESCKRLYTGKFGVWNGSLKSELRPMEKVMAN
FT                   KTRVFTAAPLDTLLAGKVCVDDFNNYFYSKNIEAPWTVGMTKFYGGWNELLTKLPDGWV
FT                   YCDADGSQFDSSLSPFLINSVLRIRLKFMEDWDLGEQMLKNLYTEIVYTAILTPDSTIV
FT                   KKFKGNNSGQPSTVVDNTLMVVLAMTYTLHKLGFEDEEQDSMCKYFVNGDDLIIAIKPE
FT                   YESLLDQFQHCFKSLGLNYDFNSRTRKREELWFMSHCGIKKDGIFIPKLEPERIVSILE
FT                   WDRSDQPVHRLEAICAAMIESWGYDKLTHEIRKFYKWCLDEAPYADLAKAGKAPYIAEC
FT                   ALKRLYTSKEASEAELEKYMEAIRSLVNDEDDDDMDEVYHQVDTKLDAGQGSKNDDKQK
FT                   SSADSKDNVITEKGSGSGQVRKDDDINAGLHGKHTIPRTKAITQKMKLPMIRGKVALNL
FT                   DHLLEYEPNQRDISNTRATQKQYESWYDGVKNDYDVDDNGMQLILNGLMVWCIENGTSP
FT                   NINGTWVMMDSEEQVEYALKPIIEHAKPTFRQIMAHFSDAAEAYIEMRNKKKPYMPRYG
FT                   RLRGLNDMGLARYAFDFYETTSATPNRAREAHNQMKAAALVGTQNRLFGMDGGGSTQEE
FT                   NTERHTAADVNQNMHTLLGVRGLH"
XX
SQ   Sequence 10080 BP; 3313 A; 2135 C; 2386 G; 2246 T; 0 other;

  X97705  Length: 10080  June 21, 2005 08:54  Type: N  Check: 4704  ..
       1  aaaataaaac aacccaacac aactcaagaa aattcataca aacaaacaaa
      51  ttcgtatttt caagcaattc actttcaagc aattacaaca ttttcaatca
     101  caaatggcaa ctctagacaa ctgcactcaa gtacaccaca tgttcgctta
     151  caatcgcgaa cacggaacaa actacacgag gaaccatttt agaaggtact
     201  tagcagccca gcgaataggc ttctattatg attgggacga tgatgtctat
     251  gaatgtccaa cgtgtgaagc tatataccat tctttggacg aaataaagaa
     301  ctggcatgag tgcgacccac cagcattcga ccttaacgac ttcataactg
     351  atgctaggtt gaaatcagca ccagttccag atctcggacc ggtgatcgtc
     401  gaaaccccaa aagtggagga aaaacaagag cttaacttct tcgctgcaac
     451  cccggcacct gaagtgttac agtggaaatg tagagggttg caattcggtt
     501  catttactga acttgaaaca tctgagccag ttgtttcggc accaaagcct
     551  aattgtgaag agccggctag gaccatcgca aagccagagg agccagtcga
     601  acaagagacc tgtggagacg gaaaaagact ccttcaggcg cagatggaag
     651  tcgacaaagc tgaacaagat cttgcattcg cttacctaag cgctagccta
     701  aaacctaggc tggagggcag aactactgca actatcgcaa gacgcaggga
     751  tggatgtttg gtttataaaa ccaaaccaag ctggtcgcag aggaagggaa
     801  caaagaagat ccttaaggtt gacaccctag cttgcaaaaa cccatacatt
     851  ccagcggttg ttgacaagat ttcaatcgca ggaggctcat cagctagtgt
     901  gatgcacgaa caacagaaac ctaaaattct gcacactaca ccatcaagaa
     951  aagtggccac gcattataaa cgaacggtga tgaaccaaca gacactcacg
    1001  gctcttataa atcaagttgg cacgattata ctaaacgcag agaaagagtt
    1051  tgaagtggtg ggctgcagaa agcaaaaagt aactggcaag ggaactagac
    1101  acaacggtgt taggctggta aagcttaaaa ctgcacatga ggaagggcat
    1151  cggagaaaag tagatatacg catccccaat ggcctgcgct caattgttac
    1201  gcgtatttca gctcggggcg gttggcacaa aacatggaca gactcagaac
    1251  tatccccagg atctagcgga tacgtattga actcgtcaaa aatcatagga
    1301  gaatttggtt taaggcgaca cagtatattc gttgttaggg ggagggtata
    1351  tggtaaaatt atagactcgc aaagtaaggt cacacacacc ctcacgcacc
    1401  gcatggttca atacagcgac gtcgcacgaa acttctggaa cggatactca
    1451  acttgtttca tgcacaacac cccaaaggac atactccata cctgcacatc
    1501  agattttgat gttaaagatt gcggcactgt cgcagcactt ttaactcaaa
    1551  cactgtttca atttgggaaa atcacctgtg gaaaatgcgc aatcgagtac
    1601  aaaaatctaa cgcgagatga gcttgccacg cgtgttaata aggagatcga
    1651  tggaaccata atcagtattc aaactcagca tccacgcttc gtgcatgtac
    1701  tcaactttct caggttaatt aaacaagtgc tcaatgctaa gaatgggaac
    1751  tttggagcat ttcaagagac ggagaggata attggggatc gaatggatgc
    1801  acctttctca cacgtaaata agttgaatgc tatcgtcatt aaaggtaatc
    1851  aagcaacgtc cgatgagatg gcacaagcat cgaaccatgt cctcgaaatc
    1901  gcgcgatatt tcaagaaccg gactgagaac atccaaaagg gctcactaaa
    1951  gtcattcagg aacaagatct ccggtaaggc acacttaaat ccgagtctta
    2001  tgtgtgacaa tcaacttgat aagaatggtg ggtttgaatg ggggcagcga
    2051  agttaccatg ccaaaaggtt tttcgacggg tacttcgaaa ccattgaccc
    2101  ttccgatggc tacagcaaat acaccataag acgcaatcca aatgggcatc
    2151  gaaagttggc aattggtaat ttgatcgtct ccacaaactt tgaatcacat
    2201  agaagaagta tggttggaga accaattgaa gaccctggtc tcactaatca
    2251  gtgcgtaagc aaagagggag gtgccttcat ctatccatgc tgctgtgtga
    2301  cagatgaata tggtaaacca acattatctg agatcaaaat gcccacaaag
    2351  catcatttag tcctaggaaa tgccggtgac cccaaatatg tggatttacc
    2401  aaaggaagcg gaaggaaaga tgttcgtagc aaaagatgga tattgttaca
    2451  taaacatttt cttggctatg ctcgtcgacg tcccagagga tcaggctaaa
    2501  gatttcacga aaatggcacg cgagatagca gtgaaacagc tcggggagtg
    2551  gccctcaatg atggatgtag caacggcttg taatatactg gctacatttc
    2601  atccagacac ccgaagatcg gaattacccc gaatcttagt cgatcatgca
    2651  acgaaaacat ttcatgttat tgactcatat ggttcaatca cgactggata
    2701  tcatattctg aaagccaata ccgtgacaca actcgtcaag ttcgctcatg
    2751  aatcactaga atccgagatg caacactaca gagtcggggg ggaaccagat
    2801  aaagcaccca gaaaaccagc tggcaatgtt ccaaccctag gaatttcaga
    2851  cctcaagaac cttggagtgg aatcagaaaa cgaagaacac tcaatccgac
    2901  caaatcttca aaggttaatc aaggcgatct acagacctcg aatgatgcgc
    2951  agcctcttaa cagaggaacc atacttatta atcttaagta ttgtatcccc
    3001  tggtgttctg atggcactct acaacagtgg ttccttggag cggacaatgc
    3051  atgagttctt gcaaactgat cagagactga gtgccaccgc ccaaatccta
    3101  aaacatctag caaagaaagt ttcactcgca aagacactta cgatccagaa
    3151  cgctatcttg gagggtggag cagggtcact gaatgaaatt cttgacgcac
    3201  ccgcgggacg atccctatca tatagactag cgaagcagac agtggaggtg
    3251  atgatggcgc ggagcgacat ggacaaggaa ttggtggacg ttggatttag
    3301  tgttcttagg gatcagaaga atgaactcat agaaaaaagt tatctcatgg
    3351  atttggagga ctcgtggcgc gcattgccat tgtgtggaaa attatcagca
    3401  atgcgagtct cgcggcgatg gcgggacacc tctactcccg aagcaatccc
    3451  aacaggtgcc gcagatttga aaggcagata cagtatctcg gttgggtctg
    3501  tttccaaaag cgcgatcttg cacctaaagg gaatttgctc aggcgcagta
    3551  aagagagtta aagacaagtg ggtcggagtg caagtgcaag gcgtgaaatg
    3601  gttagctaaa tcagtgcact acatgatacc agagctaacg aacatactga
    3651  acgttggaac cctcctccta acactgatat cgttaggcgt acgattccgg
    3701  agtctgactg gccagttcaa agagatgaag tataaagaga cgctagcaag
    3751  ggaggaggaa ctacgtaagc gcatacgcac ctacaacagt acttattatg
    3801  aaatccacgg aaagcacgct gacgccaaac aaatcaccaa gttcataacg
    3851  caccacgatc caaaactact agaagtagtt gagttttacg aaggtcctga
    3901  agaggaagaa gtagagcatc aagcaaagcg agaggaccaa gctaatctcg
    3951  aacgtattat cgcctttaca gctttagtga tgatgatgtt tgatagtgag
    4001  aggagtgatt gtgtgtacag gagtctatca aagcttaaat cattagtatc
    4051  tacgtgcgat gatgatgtac gccaccagag cgttgatgaa atcattgacc
    4101  tgttcgatga gaagaaagag acgatagatt tcgagattga aggaaaagaa
    4151  ctttactctt ctcgcgtggt agactcgaca ttcagcaagt ggtgggacaa
    4201  ccaattggtg cgaggcaaca caatggcaca ctacagaaca gaagggcact
    4251  tcatgacgtt cactcgtgaa acagctgcga gtgtggcagc cgaaattgca
    4301  cataacgagt atagagatat tctcttgcaa ggtggtgtcg gctccggcaa
    4351  gtctacaggt ctcccgtttc acttacacaa aaagggaggt gtgttactca
    4401  tcgaaccaac tcgtccgtta gctcaaaacg tatacaagca acttggaagt
    4451  aatccttttc acttgtcacc aaatttgcgc atgcgaggtg cttgcaaatt
    4501  tgggtctagc caggtaactg tggccacgag tggttatgcc ttacacttca
    4551  tagcgaacaa tgcgcaaagt cttaagatgt ttgacttcat catttttgat
    4601  gaatgtcacg tgttagatgc cagcgcaatg gcgtttaggt gcttactgca
    4651  ggagttcgaa taccaaggga agatcataaa ggtgtcagct acaccaccgg
    4701  ggaggaaact tgacttcaaa ccaatgcaca tggtcgatat tactacagaa
    4751  aatgaactat caatacagca attcgtccaa ggccaaggaa ccggagtaaa
    4801  ctgtgatgca acaaagaaag gagacaacat cttagtctac gtttcaagtt
    4851  acaacgaagt agacatgttg agcaaaatgt taaatgacaa aggctacaaa
    4901  gtgacaaagg ttgatggtag gacgatgaaa ctagggagcg tggaagtaga
    4951  aacagtaggc accccacagc ggaagcactt tgtagtggca accaacatca
    5001  tagaaaatgg cgttacattg gacgtcgatg tcgtggtgga tttcggacag
    5051  aaagtagttc ccatccttga tagtgagcac cgaatgatcc ggtatacaaa
    5101  gaaaagtatc acatatggtg agcgaatcca aagagtggga agggttgggc
    5151  gcaacaaagc tggttcagcc attcggatag gaagcactga aatggggacg
    5201  gaagaaatac cagcatcaat cgcaacagaa gcagccttct tgtgtttcac
    5251  atacggactt cctgtcatga caagcaacgt gagtacaagc gtactcggca
    5301  actgtacagt aagacaggca cggacgatgc aaaagtttga gctgtcccct
    5351  ttctttatgg tcgacctggt acaccacgac ggtacagtac acccagcaat
    5401  taacagcctc ctgagacagt tcaagttgaa agaatcggac accaaactaa
    5451  gcacgctggc aataccgaat gcagtaacca cattctggaa gagcgctcga
    5501  gagtacaact ccttaggagc ccgcacaaca atcgatgatg cagctaaaat
    5551  accatttatg atcaaggacg ttccagaaca cttgcaagaa aaactttggg
    5601  aaacaattca gcagtacaag ggcgatgcag ggtttggaag atgcacatca
    5651  gccaatgcgt gcaaaatagc atacacactc tctgtgagtc ccttcatgat
    5701  cccagcaaca atcaacaaga tcgacgccct aatggccgaa gaacgacaaa
    5751  agttggaata cttccaaaca gtaacagcca acacatgcac aatctcaaac
    5801  ttctccatta gtagtcttgg cgatatgatc aggtcgagat actcaacaaa
    5851  ccattctaga gaaaacctgc agaaattaca aacggtcaga gacacaatca
    5901  tcaactttga gtgccaggct ggaactagtg atgggggtac cttcgacatg
    5951  gagacagcac agaaattggc agaggagtat gggtgcatcg atgtcattta
    6001  tcaccaatcg aaaggagctc ttagcaaacg actcggtctc aaaggcaggt
    6051  ggaatcagag ccttatatgc aaagacctat tgattttctg cggcgtagcc
    6101  attggcggca catggatgat gtttcagagc ttcaaggacg ggatggctga
    6151  cgtaattcga caccaaggca aaggtaaacg gcaaagacag aagcttcgtt
    6201  atcgacaagc aagggataat aagatgggca ttgaagttta tggtgacgat
    6251  gcgacgatgg aacactattt tggagctgcg tacacagaga aaggaaagaa
    6301  atccggaaag acgaaaggaa tggggacgaa aaatcgaaga tttgttaaca
    6351  tgtatgggta caacccagaa gattactcgt tcatccgatt tctggaccca
    6401  ctcacaggga aaacaatgga tgaacaagta ttcactgaca taagtctcgt
    6451  ccaagatgcc tttggtaaag aaagactcaa actcctgtcc gaaggggaaa
    6501  ttgagtcaga gcacatgcga aatgggatta gagcttatct tgtcaagaat
    6551  cttaccacag cagctctcga aatagacatg acccctcaca actcttgcca
    6601  gctcggaacc aagacaaaca acatagcagg atttgtagac agggagtacg
    6651  aattgcgtca aaccggggaa gccagggttg ttgctccagc actgattcca
    6701  aaagacaatc caatcacgga cgaggatatt cccgtaaagc atgaaagcaa
    6751  gacattgttc aggggcttaa gagattataa ccctatagca tcagcaatat
    6801  gcttgctcac taacgaatca gacggaatga aagagacaat gtacggcatt
    6851  ggttttggca acacaattat tacaaaccaa cacctattca gacgcaacaa
    6901  tggcgtacta agggttcagt cgagacatgg tgaatacgtt cttccaaata
    6951  caacgcaact caaagtactt ccttgcgaag gaagggacat aatggtcatc
    7001  attcttacac cagacttccc tccgttccca caaaaactga aattccgtcc
    7051  accgatcaaa ggagagaaga tttgccttgt tggatcctta tttcaagata
    7101  agagcataac cagcaccgta tccgagacga gcgtgacaac acccgtggac
    7151  aacagcttct tgtggaaaca ctggatcact acaaaagacg gacattgcgg
    7201  gcttccacta gtatcatcaa atgatggata catagtcgga atccacagcg
    7251  ccacaagctc acggcaaaca cagaactacc atgcagcgat gcccgaagat
    7301  tttcatcaaa cacatcttat tgatccagtt tcgaaatcgt gggtgaaaca
    7351  ttggaagtat aatccagata acatggtttg gggaggcata aatctcatta
    7401  atagcacgcc aagggaaccc ttcaagataa acaaattagt gacagactta
    7451  ttcggggatg cagtacagtt tcagtccaaa caggatgagt ggttcgcaag
    7501  tcagttgaaa ggcaacttga aagcagtggg gaaaagcaca agccaactcg
    7551  tgacaaagca cacagtcaag ggtaagtgca tgatgttcga gttatacctg
    7601  caaacacacg aagaggaaaa ggaattcttc aaaccactga tgggagccta
    7651  ccagaagagc cgcttaaaca gagaagcatt tacaaaagac atcatgaaat
    7701  actccacacc gataacagta ggcatcgtcg attgtgacac gtttctgaaa
    7751  gccgaaaaag gagtcataaa acgcttagag aaacttgggt tcagtggttg
    7801  cgaatatgtc acagatgaag aggcaatatt tcaagcccta aatatgaagg
    7851  cggctgttgg tgcactatat agtggaaaga agagagatta ctttgagagc
    7901  tacggtccag aagaaaaaga gaatatcttg agagaaagct gtaagcgact
    7951  atacacaggt aagtttggag tgtggaatgg gtcactcaag tcggaactga
    8001  gacctatgga gaaagttatg gcaaataaga cacgtgtctt tacagcagcg
    8051  ccgctcgaca ctctgcttgc tggaaaagtc tgtgttgatg acttcaacaa
    8101  ttacttctac agcaaaaaca tcgaggcacc ttggacagtt ggcatgacga
    8151  agttttatgg tgggtggaac gaactcctta cgaagttacc agacggctgg
    8201  gtttattgcg atgcagatgg atcacaattc gatagttctt tgtcaccatt
    8251  tctcatcaac tcagttctca gaatacgttt aaagttcatg gaagattggg
    8301  atcttggtga acaaatgctc aaaaatttgt acacagaaat tgtatataca
    8351  gcgatcctca ctccagattc aaccatagtg aagaaattca aggggaataa
    8401  cagcggacag ccatccacgg tagtagataa cacattgatg gtcgtgctag
    8451  caatgacata cacgctgcac aagttaggct tcgaggacga ggaacaagac
    8501  tctatgtgca aatacttcgt caatggagat gacctgatca tcgcgataaa
    8551  accagaatat gaatcactac tggatcagtt ccaacactgt ttcaaaagtt
    8601  tgggcttaaa ttacgatttc aactcacgaa cgaggaagag ggaggaattg
    8651  tggttcatgt cacattgcgg catcaagaag gatggaatct tcatcccaaa
    8701  actcgaacca gagcgcattg tgtcaatcct agagtgggat agatcagacc
    8751  agccagtaca tcgcttagag gccatatgcg cagcaatgat cgaatcatgg
    8801  ggttacgaca agttaaccca tgaaattcga aaattttaca agtggtgtct
    8851  ggacgaagca ccatatgctg atttggcaaa agcgggaaaa gcaccgtaca
    8901  tagcagagtg tgctcttaaa cgattgtata ccagcaagga agccagcgaa
    8951  gcagaattag aaaaatacat ggaagccata cgtagtcttg tcaatgatga
    9001  agatgacgac gatatggatg aagtctatca tcaagtagac acgaagcttg
    9051  atgcaggcca aggcagtaaa aatgatgata aacagaagag ctcagcggat
    9101  tcaaaagata atgtcatcac ggagaaagga agtggttctg ggcaggtgag
    9151  gaaggatgac gacatcaacg cagggctaca tggcaaacac accatacctc
    9201  gtacaaaggc aatcacacag aaaatgaagt taccaatgat ccgaggtaaa
    9251  gtggctttga accttgatca tttgctggag tacgaaccaa accagagaga
    9301  catatcaaac acacgcgcga ctcaaaaaca atacgagtca tggtacgacg
    9351  gagttaagaa tgactatgat gtggatgata atggcatgca attaattctg
    9401  aacggattga tggtttggtg tatagaaaac gggacatccc cgaatataaa
    9451  tggaacatgg gtgatgatgg acagtgaaga acaagtagaa tatgctctga
    9501  aacccatcat cgaacacgcg aaacccacgt ttcgccagat aatggcccat
    9551  tttagtgacg cagccgaggc gtacattgag atgagaaaca agaagaaacc
    9601  gtatatgcca cgatacggac ggctacgagg cttgaacgat atggggttag
    9651  ctcgctacgc tttcgacttt tacgaaacaa catcagcgac cccaaatcgg
    9701  gcgagagagg cgcacaatca aatgaaggca gctgctctag tgggaacaca
    9751  gaacagactg tttggaatgg atggaggcgg ttcaacccag gaagagaaca
    9801  cggagaggca cacagccgca gatgtaaatc agaatatgca cactctctta
    9851  ggcgtgagag ggttgcacta aaggcgtgtg ttggcattta aagactgtag
    9901  tataaatcta taatatagtg agtgtttcac tccttttatg tttatgtatg
    9951  cacttatttg tccgttagta ttctctccct gtacttcgct cgtaagggcg
   10001  taggttcagc tgagggcttt tctagtttcc gctgtgaggt tttacctcga
   10051  aggttgctag tctggttttc agtcggagac