!!NA_SEQUENCE 1.0
ID   TRVRNA2CP  standard; genomic RNA; VRL; 3855 BP.
XX
AC   Z36974;
XX
SV   Z36974.2
XX
DT   07-SEP-1994 (Rel. 40, Created)
DT   21-OCT-2003 (Rel. 77, Last updated, Version 12)
XX
DE   Tobacco rattle virus genes for coat protein, 28.7 kDa & 32.8 kDa proteins,
DE   genomic RNA
XX
KW   28.7 kDa protein; 32.8 kDa protein; coat protein.
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-3855
RX   MEDLINE; 96068819.
RX   PUBMED; 7595393.
RA   Hernandez C., Mathis A., Brown D.J.F., Bol J.F.;
RT   "Sequence of RNA 2 of a nematode-transmissible isolate of tobacco rattle
RT   virus";
RL   J. Gen. Virol. 76:2847-2851(1995).
XX
RN   [2]
RC   revised by [4]
RA   Hernandez C.;
RT   ;
RL   Submitted (03-SEP-1994) to the EMBL/GenBank/DDBJ databases.
RL   Hernandez C., Institute of Mol. Plant Sciences, Einsteinweg 55, 2300 RA
RL   Leiden, The Netherlands
XX
RN   [3]
RA   Hernandez C.;
RT   ;
RL   Submitted (02-MAR-1995) to the EMBL/GenBank/DDBJ databases.
RL   Hernandez C., Institute of Mol. Plant Sciences, Einsteinweg 55, 2300 RA
RL   Leiden, The Netherlands
XX
RN   [4]
RP   1-3855
RA   Hernandez C.;
RT   ;
RL   Submitted (05-MAY-1999) to the EMBL/GenBank/DDBJ databases.
RL   Hernandez C., Institute of Mol. Plant Sciences, Einsteinweg 55, 2300 RA
RL   Leiden, The Netherlands
XX
DR   GOA; Q88897.
DR   SPTREMBL; Q88897; Q88897.
DR   SPTREMBL; Q88898; Q88898.
DR   SPTREMBL; Q88899; Q88899.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3855
FT                   /db_xref="taxon:12295"
FT                   /mol_type="genomic RNA"
FT                   /organism="Tobacco rattle virus"
FT                   /clone="pK20"
FT                   /isolate="PPK20"
FT                   /segment="RNA2"
FT   CDS             557. .1171
FT                   /db_xref="GOA:Q88897"
FT                   /db_xref="SPTREMBL:Q88897"
FT                   /note="High homology with other tobraviral coat proteins"
FT                   /function="coat protein"
FT                   /product="22.3K"
FT                   /standard_name="coat protein"
FT                   /protein_id="CAA85421.1"
FT                   /translation="MGDMYDESFDKSGGPADLMDDSWVESVSWKDLLKKLHSIKFALQS
FT                   GRDEITGLLAALNRQCPYSPYEQFPDKKVYFLLDSRANSALGVIQNASAFKRRADEKNA
FT                   VAGVTNIPANPNTTVTTNQGSTTTTKANTGSTLEEDLYTYYKFDDASTAFHKSLTSLEN
FT                   MELKSYYRRNFEKVFGIKFGGAAASSSAPPPASGGPIRPNP"
FT   CDS             1340. .2404
FT                   /db_xref="SPTREMBL:Q88898"
FT                   /function="unknown"
FT                   /product="28.7K"
FT                   /protein_id="CAA85422.2"
FT                   /translation="MHELLRKWLDDTNVLLLDNGLVVKVRSRVPHIRTYEVIGKLSVFD
FT                   NSLGDDTLFEGKVENVFVFMFRRFLCVNKDGHCYSRKHDELYYYGRVDLDSVSKVTSGY
FT                   EKLFIHRELYILTDLIERVSKFFNLAQDVVEASFEYAKVEERLGHVRNVLQLAGGKSTN
FT                   ADLTIKISDDVEQLLGKRGGFLKVVNGILSKNGSDVVTNDNELIHAINQNLVPDKVMSV
FT                   SNVMKETGFLQFPKFLSKLEGQVPKGTKFLDKHVPDFTWIQALEERVNIRRGESGLQTL
FT                   LADIVPRNAIAAQKLTMLGYIEYHDYVVIVCQSGVFSDDWATCRMLWAALSSAQLYTYV
FT                   DASRIGPIVYGWLL"
FT   CDS             2587. .>3455
FT                   /db_xref="SPTREMBL:Q88899"
FT                   /function="unknown"
FT                   /product="32.8K"
FT                   /protein_id="CAA85423.2"
FT                   /translation="MVIVTKGAYVHEFPRTAEWNAFAQILSREHGYIVSDTALEGAAKP
FT                   YYVVNSSGFYGPPGLDGLISTLDRELQYYSKLLYEIKGLGVMSDENVFGTQYDGNLTAR
FT                   VSRLERRLNPMSNIGSSSRPWSEHKSAVKKADLERYVYANFADWSNHLGPAGKSTREVV
FT                   KYLMYRMGYYSDTSGIGHDLNYKHFRDHLDIYNLTCSPPFLVSSAVVDGHYARDKFVSF
FT                   QGVCGFNPMFPDVNGLKSSWSLGRQLDDIRSQKKEVSGTNQEPNYYYDGDTLKPIGSGA
FT                   SVVGERRPG"
XX
SQ   Sequence 3855 BP; 1078 A; 647 C; 960 G; 1170 T; 0 other;

 Z36974  Length: 3855  October 28, 2003 08:57  Type: N  Check: 6087  ..
       1  ataaaacatt gcacctatgg tgttgccctg gctggggtat gtcagtgatc
      51  gcagtagaat gtactaattg acaagttgga gaatacggta gaacgtcctt
     101  atccaacaca gcctttatcc ctctccctga cgaggttttt gtcagtgtaa
     151  tatttctttt tgaactatcc agcttagtac cgtacgggaa agtgactggt
     201  gtgcttatct ttgaaatgtt actttgggtt tcggttcttt aggttagtaa
     251  gaaagcactt gtcttctcat acaaaggaaa acctgacgta tcgcttacga
     301  aagtagcaat gaaagaaagg tggtggtttt aatcgtaccg caaaaaacga
     351  tggggtcgtt ttaattaact tctcctacaa gcgtctaaac ggacgttggg
     401  gttttgctag tttctttaga gaaaactagc taagtcttta atgttatcat
     451  tagagatggc ataaatataa tacttgtgtc tgctgataag atcattttaa
     501  tttggacgat tagacttgtt gaactacagg ttactgaatc acttgcgcta
     551  atcaacatgg gagatatgta cgatgaatca tttgacaagt cgggcggtcc
     601  tgctgacttg atggacgatt cttgggtgga atcagtttcg tggaaagatt
     651  tgttgaagaa gttacacagc ataaaatttg cactacagtc tggtagagat
     701  gagatcactg ggttactagc ggcactgaat agacagtgtc cttattcacc
     751  atatgagcag tttccagata agaaggtgta tttcctttta gactcacggg
     801  ctaacagtgc tcttggtgtg attcagaacg cttcagcgtt caagagacga
     851  gctgatgaga agaatgcagt ggcgggtgtt acaaatattc ctgcgaatcc
     901  aaacacaacg gttacgacga accaagggag tactactact accaaggcga
     951  acactggctc gactttggaa gaagacttgt acacttatta caaattcgat
    1001  gatgcctcta cagctttcca caaatctcta acttcgttag agaacatgga
    1051  gttgaagagt tattaccgaa ggaactttga gaaagtattc gggattaagt
    1101  ttggtggagc agctgctagt tcatctgcac cgcctccagc gagtggaggt
    1151  ccgatacgtc ctaatcccta gggatttaag gacgtgaact ctgttgagat
    1201  ctctgtgaaa ttcagagggt gggtgatacc atattcactg atgccattag
    1251  cgacatctaa atagggctaa ttgtgactaa tttgagggaa tttcctttac
    1301  cattgacgtc agtgtcgttg gtagcatttg agtttcgcaa tgcacgaatt
    1351  acttaggaag tggcttgacg acactaatgt gttattgtta gataatggtt
    1401  tggtggtcaa ggtacgtagt agagtcccac atattcgcac gtatgaagta
    1451  attggaaagt tgtcagtttt tgataattca ctgggagatg atacgctgtt
    1501  tgagggaaaa gtagagaacg tatttgtttt tatgttcagg cggttcttgt
    1551  gtgtcaacaa agatggacat tgttactcaa ggaagcacga tgagctttat
    1601  tattacggac gagtggactt agattctgtg agtaaggtta cctcagggta
    1651  cgagaaactc tttattcaca gagaacttta tatcttaaca gatttaattg
    1701  agagagtgag taagttcttt aacttagctc aggatgtggt agaagcaagt
    1751  tttgagtatg ccaaggttga agagaggtta ggtcacgtca gaaacgtgtt
    1801  gcaactggcg ggtggaaaat ccacgaatgc cgatttgaca attaagattt
    1851  ctgacgatgt cgaacaactg cttggaaaac gtggtggatt cttgaaggtt
    1901  gtgaacggta tcttgagcaa gaatggtagt gacgtagtca ctaacgacaa
    1951  tgagcttatt catgcaatta accaaaatct ggtaccagat aaagtcatgt
    2001  ctgtgtcgaa cgtaatgaaa gagactgggt ttctgcagtt tccaaagttt
    2051  ttatctaagt tggaaggaca ggtaccgaaa ggaacaaaat ttctagacaa
    2101  acacgttcct gattttactt ggatacaagc tcttgaagaa agagtgaata
    2151  ttcggagagg agaatcggga cttcagactc tattagctga tatcgttccg
    2201  aggaatgcta ttgctgctca gaaattgaca atgctaggtt acatcgagta
    2251  tcacgactat gtggtgatcg tctgtcagtc tggagtattt agtgacgatt
    2301  gggcgacatg tagaatgctt tgggcagcac tatctagtgc tcaactatat
    2351  acctatgttg acgccagtag aatcggtcca atcgtttacg gttggttatt
    2401  gtgattggtt gatgaggaaa ttctgtttga aggctggttg aaagtaccag
    2451  ggcgggagaa gccatattct ctatcgttgt aggaagcgat tgaaataatt
    2501  cctgtggtca cgtcgcacgt gaggtggttg ttaccataaa caataatgtc
    2551  gttggcagca tttaaaataa ttccatagtt actaagatgg tgattgtgac
    2601  caaaggagcg tatgttcatg aatttccgcg tacggctgag tggaatgctt
    2651  ttgctcaaat tttgagtaga gaacacggtt atattgtatc agatacagca
    2701  ttggagggag cggcgaaacc ttattacgtt gtgaacagta gtgggtttta
    2751  tggtcctccg ggcttagatg gtctaatttc taccttggat agagagcttc
    2801  agtattactc gaagttgtta tacgaaatca aaggacttgg tgttatgtca
    2851  gatgaaaacg tctttggtac acagtatgat ggaaatctta ctgcaagagt
    2901  gtctcgtctt gaacgcagac taaaccctat gtcaaacatt gggtctagtt
    2951  cgcgtccttg gagtgaacat aagagtgctg ttaaaaaggc tgacttggaa
    3001  cgatatgtgt acgccaactt cgccgattgg tcgaatcatt tagggccggc
    3051  tgggaagagt actcgcgagg tcgtaaagta tttgatgtac cgaatgggct
    3101  attacagtga tacatctggg atcgggcatg atctgaatta caaacatttc
    3151  cgggaccatc ttgatattta caacttaact tgttctcccc ctttcctggt
    3201  gagcagtgcg gttgtagatg gacactacgc acgggataag ttcgttagtt
    3251  ttcaaggtgt atgtgggttc aatccgatgt ttccagacgt gaatggtttg
    3301  aagagtagtt ggtctttagg tcgtcaactg gatgatatac ggtctcaaaa
    3351  gaaagaggtt tctggaacaa accaggagcc aaactattac tacgatggcg
    3401  acacactaaa accgatcggt tcaggtgcga gcgttgtagg agagagaagg
    3451  ccgggatgga ggtgaatgtc ccgaagacat taaactacgt tctttaagta
    3501  gatccgtgcc tgaagtttta ggttcaattt aaacctacga gattgacatt
    3551  ctcgactgat cttgattgat cggtaagtct tttgtaattt aattttcttt
    3601  ttgattttat tttaaattgt tatctgtttc tgtgtataga ctgtttgaga
    3651  tcggcgttta ggctcattgt cttaccatag gggaacggac tttgtttgtg
    3701  ttgttatttt atttgtattt tattaaaatt ctcaacgatc tgaaaaagcc
    3751  tcgcgctaag agattgttgg ggggtgagta agtactttta aagtgatgat
    3801  ggttacaaag gcaaaagggg taaaacccct cgcctacgta agcgttatta
    3851  cgccc