!!NA_SEQUENCE 1.0
ID   TRVCOAT    standard; RNA; VRL; 3357 BP.
XX
AC   Z97357;
XX
SV   Z97357.1
XX
DT   07-JAN-1999 (Rel. 58, Created)
DT   07-JAN-1999 (Rel. 58, Last updated, Version 1)
XX
DE   Tobacco rattle virus RNA encoding coat protein.
XX
KW   27 kDa protein; 9kDA protein; coat protein.
XX
OS   Tobacco rattle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tobravirus.
XX
RN   [1]
RP   1-3357
RA   Uhde K., Koenig R., Lesemann D.;
RT   "RNA 2 of an onion isolate of tobacco rattle virus: a further example for
RT   the diversity of the smaller RNA species of tobraviruses.";
RL   Unpublished.
XX
RN   [2]
RA   Koenig R.;
RT   ;
RL   Submitted (04-JUL-1997) to the EMBL/GenBank/DDBJ databases.
RL   Koenig R., Biologische Bundesanstalt Land- und Forstwirtschaft, Institut
RL   Biochemie/Pflanzenvirologie, Messeweg 11, Braunschweig, D38104, Germany
XX
DR   SPTREMBL; Q9YN74; Q9YN74.
DR   SPTREMBL; Q9YN75; Q9YN75.
DR   SPTREMBL; Q9YN76; Q9YN76.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3357
FT                   /db_xref="taxon:12295"
FT                   /organism="Tobacco rattle virus"
FT                   /strain="ON"
FT   5'UTR           1. .709
FT   CDS             710. .1342
FT                   /db_xref="SPTREMBL:Q9YN76"
FT                   /product="coat protein"
FT                   /protein_id="CAB10581.1"
FT                   /translation="MAGTYGESFEGKILDDLSGAWVEKHNWSDVLKRLTKIKFALQADR
FT                   DMIPGIVEDLNTEIPVDEFTRFPAGKVYHLLSKEVLMAIEAIHAASSFKRRAEEKNNVN
FT                   PRQRFDAEGSATQLNPGGTVVRPATGNNDSSLGEDMFSNSKLDDASTAFHKSLATLKGS
FT                   RPKAVVQRTFEREYSLKWATGAAGAPASGNAVSGGGTPPGGGRGPNP"
FT   CDS             1473. .2189
FT                   /db_xref="SPTREMBL:Q9YN75"
FT                   /product="27kDa protein"
FT                   /function="unknown"
FT                   /protein_id="CAB10582.1"
FT                   /translation="MVNGDWADKWPVENLFVDDFGKLVWFDILDDVVRITHFVSQVPTD
FT                   LSNIPKAFISFIDNRVPMCINSKGWMFIRVKVDGEDVYYQKLGELDVSSFGDSMLPPDF
FT                   EFKFTKITVPVDKQLVSKVNSLEKLNAQLATDLSQARTLKNFEELREGLVLNYSKAGGR
FT                   LFRMVVRMIGGNWKLVSEINNDSDRWATLSANLILKLDAQYLGYKVVKRFNVVGLEFDL
FT                   ARLNAMDVPTLLASVV"
FT   CDS             2364. .2606
FT                   /db_xref="SPTREMBL:Q9YN74"
FT                   /product="9kDa protein"
FT                   /function="unknown"
FT                   /protein_id="CAB10583.1"
FT                   /translation="MGDVCSAFIIELTTEVTFSVWFNKKNFVTNSGRVFPFNGAIPKIG
FT                   NWLVVYCHWWPDGSTTIHLSTRSHNVDVGKSCHCT"
FT   3'UTR           2607. .3357
FT   misc_feature    2837. .3357
FT                   /note="TRV RNA 1-like"
XX
SQ   Sequence 3357 BP; 957 A; 551 C; 786 G; 1063 T; 0 other;

Z97357  Length: 3357  December 21, 2001 16:07  Type: N  Check: 5872  ..
       1  ataaaacatc gcacctctgg tgctgccctg gctggggtat gtctttgatc
      51  gcagtaaaat gtactaattg acaagttgga gaacgcggta gaacgtactt
     101  atccgacaca gcctttatcc ctcttcctga cgaggttttt gtcagcgtat
     151  catgttgttt tgaacattcc aacttagtac caaaagggga aagtgattgg
     201  tgtgcctatc ttcgatatga tgctttgaat tttgaatagt aggaagttag
     251  aaaagaaact cttgtcttct caaacaagta aaacctgaga cgtgttaact
     301  acgaaagtgt ccattttaaa ttctgtggtt gaatgttgtg ttcaactgtg
     351  gaaaccaaaa ccgatgtgag aagaaccaga ctaatacttt ggtctgaagt
     401  gttcctacaa tcgcaagggt gtgttaaagc cctggggttt ttctgatttc
     451  tttagagaaa attagataag atcttgatat tattattgag gtcggcataa
     501  ttatactgat tgtgtcctcg ttgatagaga ctatcatctg tcattcatct
     551  caagaagcag tggcattggt tcggaacgac cttatttctt agttatttaa
     601  ctaggaattg cataaattca acaaaagttg ctaagcgact tattctgaac
     651  actttgataa gaagatttgc tgaaacactg gttgcttaat cacttactct
     701  tcttcactaa tggctgggac gtatggagag tcttttgaag gaaagatctt
     751  agatgatctg tctggggctt gggtcgagaa gcataattgg agcgatgttc
     801  ttaaaaggtt gacaaagata aaattcgcct tacaagccga tagggatatg
     851  attcctggaa ttgtggaaga tttgaacact gaaattccag tggatgaatt
     901  tactagattt ccggctggta aggtttatca cctactatcc aaagaagtgc
     951  tgatggcgat tgaagctatt cacgctgcgt cctccttcaa aagaagagca
    1001  gaagaaaaga acaatgtcaa tcccaggcag cggtttgatg ccgaagggtc
    1051  tgcaacgcag ttaaacccag ggggaaccgt ggttagaccc gctactggta
    1101  acaacgattc gtctctgggc gaagatatgt tttctaatag taagttagac
    1151  gacgctagca cggcttttca taagagttta gctacgttaa agggcagtcg
    1201  gcctaaagca gttgtccaaa gaacatttga aagagaatac agtctgaagt
    1251  gggcgacagg agcggctgga gcaccggcga gtggtaatgc agtatcaggt
    1301  ggtggtactc cacctggcgg cggacgtggt ccgaatcctt gattctctca
    1351  accttgtcgg tattttatgg tctgtttgac catttggttt tgatttcgaa
    1401  tggcgttggg ttacgaatac gatcgcagtt ttaaatgtct tttgactttt
    1451  gtcgcagaca gcatatgtga aaatggttaa cggagattgg gctgataaat
    1501  ggccagttga aaatttgttc gttgatgatt ttggaaaatt ggtgtggttt
    1551  gatattctag atgatgtggt tcgcatcact catttcgttt ctcaagtgcc
    1601  aacagatctt tcgaatatac ctaaagcatt catctccttc attgataacc
    1651  gagtccctat gtgtataaat tccaaaggtt ggatgttcat aagggttaag
    1701  gtcgatgggg aagacgttta ctatcagaaa ttgggggaac tagacgtttc
    1751  ttctttcggg gattcaatgt tgccgcctga cttcgagttc aaatttacga
    1801  agattacagt gcctgttgat aaacaactgg ttagtaaagt taactcttta
    1851  gagaagttaa atgctcaact agcgacagat ctcagtcaag ctcgtactct
    1901  taaaaatttt gaagaacttc gagaaggttt agtgttgaat tattcaaaag
    1951  caggaggtcg gctcttcagg atggtggtaa gaatgatagg tggaaactgg
    2001  aagttagttt ccgaaatcaa caatgattca gatagatggg ccactttgag
    2051  cgctaacttg atccttaaac tggatgcaca atacttaggc tacaaagttg
    2101  taaaaagatt taatgtggtc ggacttgaat tcgatttagc aaggttgaac
    2151  gcgatggacg ttccaacttt gttagcgtct gttgtgtaaa tcgaaacatt
    2201  tatgtaggtc gatcacatcg acggtggcct agaccatact aggtgaagtt
    2251  gtgggaagct tcgaaaataa ttctcgtagg caaatctcat ttgcggtggt
    2301  tgttaccata aacaataatg tcgttggttg cacttaaaat aattcctttt
    2351  gtctgttggc gatatgggag atgtgtgtag tgcatttatt attgaattaa
    2401  ctacggaagt tactttctcc gtgtggttca ataagaagaa ctttgtcact
    2451  aattctggtc gtgtgtttcc tttcaatggt gctataccaa agatcggtaa
    2501  ctggttagtc gtttattgtc attggtggcc tgatggttca acaacaatac
    2551  atctgtcaac aaggtctcac aatgtcgacg tcggaaagtc ttgtcactgc
    2601  acttgactgg gatcaagtgg ctaaagacag tgtctttggg tcgacgtact
    2651  caacttaagc aagacatttg tcgaaggacg ttgaaatcaa tcacctactg
    2701  agtaatttct tacctagaaa actgtttgcg cagttagtaa agatagaaag
    2751  gaaagttgac tggagttgat tttgttgagg aagtttgtta gtatttatgt
    2801  tacttacttg atttttctgt tatgattata gttagtttat caatgatttt
    2851  acttttgatg tgtatacttg ttgtagtcgt agtcgctttg gaaaatgtcg
    2901  taaacgcgtt gaagcaagaa atcgagagat ccggaaacgg attcgacgaa
    2951  atcaagctga aaacacgtct tcgacaccta aaatgtttca taattcgaaa
    3001  acctctaaga agaaattcaa aggggccaga gaatttggaa caccaaaaag
    3051  atttttaaga gatgatgttc ctttgggaat tgatcaatta tttgctttta
    3101  aattttgttt taaattgtta tctgtttctg tgtatagact gtttgagatt
    3151  ggcgtttggc cgactcattg tcttaccata ggggaacgga ctttgtttgt
    3201  gttgttattt tatttgtatt ttattaaaat tctcaatgat ctgaaaaagc
    3251  tttattgcta agagattatt ggggggtgag taagtacttt taaagtgatg
    3301  atggttacaa aggcaaaagg ggtaaaaccc ctcgcctacg taagcgttat
    3351  tacgccc