ID   DQ641257; SV 1; linear; genomic RNA; STD; VRL; 7310 BP.
XX
AC   DQ641257;
XX
DT   20-JUN-2006 (Rel. 88, Created)
DT   22-APR-2008 (Rel. 95, Last updated, Version 3)
XX
DE   Seneca valley virus isolate SVV-001 polyprotein gene, complete cds.
XX
KW   .
XX
OS   Seneca valley virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales;
OC   Picornaviridae.
XX
RN   [1]
RP   1-7310
RX   PUBMED; 18420805.
RA   Hales L.M., Knowles N.J., Reddy P.S., Xu L., Hay C., Hallenbeck P.L.;
RT   "Complete genome sequence analysis of Seneca Valley virus-001, a novel
RT   oncolytic picornavirus";
RL   J. Gen. Virol. 89(PT 5):1265-1275(2008).
XX
RN   [2]
RP   1-7310
RA   Hales L.M., Reddy P.S., Hay C., Hallenbeck P.L.;
RT   ;
RL   Submitted (16-MAY-2006) to the EMBL/GenBank/DDBJ databases.
RL   Biology, Neotropix, Inc., 371 Phoenixville Pike, Malvern, PA 19355, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7310
FT                   /organism="Seneca valley virus"
FT                   /isolate="SVV-001"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:390157"
FT   CDS             667. .7212
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:Q155Z9"
FT                   /db_xref="InterPro:IPR000199"
FT                   /db_xref="InterPro:IPR000605"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001676"
FT                   /db_xref="InterPro:IPR004004"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR014759"
FT                   /db_xref="InterPro:IPR015031"
FT                   /db_xref="UniProtKB/TrEMBL:Q155Z9"
FT                   /protein_id="ABG23522.1"
FT                   /translation="MQNSHFSFDTASGTFEDVTGTKVKIVEYPRSVNNGVYDSSTHLEI
FT                   LNLQGEIEILRSFNEYQIRAAKQQLGLDIVYELQGNVQTTSKNDFDSRGNNGNMTFNYY
FT                   ANTYQNSVDFSTSSSASGAGPGNSRGGLAGLLTNFSGILNPLGYLKDHNTEEMENSADR
FT                   VTTQTAGNTAINTQSSLGVLCAYVEDPTKSDPPSSSTDQPTTTFTAIDRWYTGRLNSWT
FT                   KAVKTFSFQAVPLPGAFLSRQGGLNGGAFTATLHRHFLMKCGWQVQVQCNLTQFHQGAL
FT                   LVAMVPETTLDVKPDGKAKSLQELNEEQWVEMSDDYRTGKNMPFQSLGTYYRPPNWTWG
FT                   PNFINPYQVTVFPHQILNARTSTSVDINVPYIGETPTQSSETQNSWTLLVMVLVPLDYK
FT                   EGATTDPEITFSVRPTSPYFNGLRNRYTAGTDEEQGPIPTAPRENSLMFLSTLPDDTVP
FT                   AYGNVRTPPVNYLPGEITDLLQLARIPTLMAFERVPEPVPASDTYVPYVAVPTQFDDRP
FT                   LISFPITLSDPVYQNTLVGAISSNFANYRGCIQITLTFCGPMMARGKFLLSYSPPNGTQ
FT                   PQTLSEAMQCTYSIWDIGLNSSWTFVVPYISPSDYRETRAITNSVYSADGWFSLHKLTK
FT                   ITLPPDCPQSPCILFFASAGEDYTLRLPVDCNPSYVFHSTDNAETGVIEAGNTDTDFSG
FT                   ELAAPGSNHTNVKFLFDRSRLLNVIKVLEKDAVFPRPFPTQEGAQQDDGYFCLLTPRPT
FT                   VASRPATRFGLYANPSGSGVLANTSLDFNFYSLACFTYFRSDLEVTVVSLEPDLEFAVG
FT                   WFPSGSEYQASSFVYDQLHVPFHFTGRTPRAFASKGGKVSFVLPWNSVSSVLPVRWGGA
FT                   SKLSSATRGLPAHADWGTIYAFVPRPNEKKSTAVKHVAVYIRYKNARAWCPSMLPFRSY
FT                   KQKMLMQSGDIETNPGPASDNPILEFLEAENDLVTLASLWKMVHSVQQTWRKYVKNDDF
FT                   WPNLLSELVGEGSVALAATLSNQASVKALLGLHFLSRGLNYTDFYSLLIEKCSSFFTVE
FT                   PPPPPAENLMTKPSVKSKFRKLFKMQGPMDKVKDWNQIAAGLKNFQFVRDLVKEVVDWL
FT                   QAWINKEKASPVLQYQLEMKKLGPVALAHDAFMAGSGPPLSDDQIEYLQNLKSLALTLG
FT                   KTNLAQSLTTMINAKQSSAQRVEPVVVVLRGKPGCGKSLASTLIAQAVSKRLYGSQSVY
FT                   SLPPDPDFFDGYKGQFVTLMDDLGQNPDGQDFSTFCQMVSTAQFLPNMADLAEKGRPFT
FT                   SNLIIATTNLPHFSPVTIADPSAVSRRINYDLTLEVSEAYKKHTRLNFDLAFRRTDAPP
FT                   IYPFAAHVPFVDVAVRFKNGHQNFNLLELVDSICTDIRAKQQGARNMQTLVLQSPNEND
FT                   DTPVDEALGRVLSPAAVDEALVDLTPEADPVGRLAILAKLGLALAAVTPGLIILAVGLY
FT                   RYFSGSDADQEETESEGSVKAPRSENAYDGPKKNSKPPGALSLMEMQQPNVDMGFEAAV
FT                   AKKVVVPITFMVPNRPSGLTQSALLVTGRTFLINEHTWSNPSWTSFTIRGEVHTRDEPF
FT                   QTVHFTHHGIPTDLMMVRLGPGNSFPNNLDKFGLDQMPARNSRVVGVSSSYGNFFFSGN
FT                   FLGFVDSITSEQGTYARLFRYRVTTYKGWCGSALVCEAGGVRRIIGLHSAGAAGIGAGT
FT                   YISKLGLIKALKHLGEPLATMQGLMTELEPGITVHVPRKSKLRKTTAHAVYKPEFEPAV
FT                   LSKFDPRLNKDVDLDEVIWSKHTANVPYQPPLFYTYMSEYAHRVFSFLGKDNDILTVKE
FT                   AILGIPGLDPMDPHTAPGLPYAINGLRRTDLVDFVNGTVDAALAVQIQKFLDGDYSDHV
FT                   FQTFLKDEIRPSEKVRAGKTRIVDVPSLAHCIVGRMLLGRFAAKFQSHPGFLLGSAIGS
FT                   DPDVFWTVIGAQLEGRKNTYDVDYSAFDSSHGTGSFEALISHFFTVDNGFSPALGPYLR
FT                   SLAVSVHAYGERRIKITGGLPSGCAATSLLNTVLNNVIIRTALALTYKEFEYDMVDIIA
FT                   YGDDLLVGTDYDLDFNEVARRAAKLGYKMTPANKGSVFPPTSSLSDAVFLKRKFVQNND
FT                   GLYKPVMDLKNLEAMLSYFKPGTLLEKLQSVSMLAQHSGKEEYDRLMHPFADYGAVPSH
FT                   EYLQARWRALFD"
XX
SQ   Sequence 7310 BP; 1743 A; 2053 C; 1705 G; 1809 T; 0 other;

dq641257 Length: 7310  22-APR-2008  Type: N  Check: 1471  ..
       1  tttgaaatgg ggggctgggc cctgatgccc agtccttcct ttccccttcc
      51  ggggggttaa ccggctgtgt ttgctagagg cacagagggg caacatccaa
     101  cctgcttttg cggggaacgg tgcggctccg attcctgcgt cgccaaaggt
     151  gttagcgcac ccaaacggcg cacctaccaa tgttattggt gtggtctgcg
     201  agttctagcc tactcgtttc tcccccgacc attcactcac ccacgaaaag
     251  tgtgttgtaa ccataagatt taacccccgc acgggatgtg cgataaccgt
     301  aagactggct caagcgcgga aagcgctgta accacatgct gttagtccct
     351  ttatggctgc aagatggcta cccacctcgg atcactgaac tggagctcga
     401  ccctccttag taagggaacc gagaggcctt cgtgcaacaa gctccgacac
     451  agagtccacg tgactgctac caccatgagt acatggttct cccctctcga
     501  cccaggactt ctttttgaat atccacggct cgatccagag ggtggggcat
     551  gacccctagc atagcgagct acagcgggaa ctgtagctag gccttagcgt
     601  gccttggata ctgcctgata gggcgacggc ctagtcgtgt cggttctata
     651  ggtagcacat acaaatatgc agaactctca tttttctttc gatacagcct
     701  ctggcacctt tgaagatgta accggaacaa aagtcaagat cgttgaatac
     751  cccagatcgg tgaacaatgg tgtttacgat tcgtctactc atttggagat
     801  actgaaccta cagggtgaaa ttgaaatttt aaggtctttc aatgaatacc
     851  aaattcgcgc cgccaaacaa caactcggac tggacatcgt gtacgaacta
     901  cagggtaatg ttcagacaac gtcaaagaat gattttgatt cccgtggcaa
     951  taatggtaac atgaccttca attactacgc aaacacttat cagaattcag
    1001  tagacttctc gacctcctcg tcggcgtcag gcgccggacc cgggaactcc
    1051  cggggcggat tagcgggtct cctcacaaat ttcagtggaa tcttgaaccc
    1101  tcttggctac ctcaaagatc acaacaccga agaaatggaa aactctgctg
    1151  atcgagtcac aacgcaaacg gcgggcaaca ctgccataaa cacgcaatca
    1201  tcattgggtg tgttgtgtgc ctacgttgaa gacccgacca aatctgatcc
    1251  tccgtccagc agcacagatc aacccaccac cactttcact gccatcgaca
    1301  ggtggtacac tggacgtctc aattcttgga caaaagctgt aaaaaccttc
    1351  tcttttcagg ccgtcccgct tcccggggcc tttctgtcta ggcagggagg
    1401  cctcaacgga ggggccttca cagctaccct acatagacac tttttgatga
    1451  agtgcgggtg gcaggtgcag gtccaatgta atttgacaca attccaccaa
    1501  ggcgctcttc ttgttgccat ggttcctgaa accacccttg atgtcaagcc
    1551  cgacggtaag gcaaagagct tacaggagct gaatgaagaa cagtgggtgg
    1601  aaatgtctga cgattaccgg accgggaaaa acatgccttt tcagtctctt
    1651  ggcacatact atcggccccc taactggact tggggtccca atttcatcaa
    1701  cccctatcaa gtaacggttt tcccacacca aattctgaac gcgagaacct
    1751  ctacctcggt agacataaac gtcccataca tcggggagac ccccacgcaa
    1801  tcctcagaga cacagaactc ctggaccctc ctcgttatgg tgctcgttcc
    1851  cctagactat aaggaaggag ccacaactga cccagaaatt acattttctg
    1901  taaggcctac aagtccctac ttcaatgggc ttcgcaaccg ctacacggcc
    1951  gggacggacg aagaacaggg gcccattcct acggcaccca gagaaaattc
    2001  gcttatgttt ctctcaaccc tccctgacga cactgtccct gcttacggga
    2051  atgtgcgtac ccctcctgtc aattacctcc ctggtgaaat aaccgacctt
    2101  ttgcaactgg cccgcatacc cactctcatg gcatttgagc gggtgcctga
    2151  acccgtgcct gcctcagaca catatgtgcc ctacgttgcc gttcccaccc
    2201  agttcgatga caggcctctc atctccttcc cgatcaccct ttcagatccc
    2251  gtctatcaga acaccctggt tggcgccatc agttcaaatt tcgccaatta
    2301  ccgtgggtgt atccaaatca ctctgacatt ttgtggaccc atgatggcga
    2351  gagggaaatt cctgctctcg tattctcccc caaatggaac gcaaccacag
    2401  actctttccg aagctatgca gtgcacatac tctatttggg acataggctt
    2451  gaactctagt tggaccttcg tcgtccccta catctcgccc agtgactacc
    2501  gtgaaactcg agccattacc aactcggttt actccgctga tggttggttt
    2551  agcctgcaca agttgaccaa aattactcta ccacctgact gtccgcaaag
    2601  tccctgcatt ctctttttcg cttctgctgg tgaggattac actctccgtc
    2651  tccccgttga ttgtaatcct tcctatgtgt tccactccac cgacaacgcc
    2701  gagaccgggg ttattgaggc gggtaacact gacaccgatt tctctggtga
    2751  actggcggct cctggctcta accacactaa tgtcaagttc ctgtttgatc
    2801  gatctcgatt attgaatgta atcaaggtac tggagaagga cgccgttttc
    2851  ccccgccctt tccctacaca agaaggtgcg cagcaggatg atggttactt
    2901  ttgtcttctg accccccgcc caacagtcgc ttcccgaccc gccactcgtt
    2951  tcggcctgta cgccaatccg tccggcagtg gtgttcttgc taacacttca
    3001  ctggacttca atttttatag cttggcctgt ttcacttact ttagatcgga
    3051  ccttgaggtt acggtggtct cactagagcc ggatctggaa tttgctgtag
    3101  ggtggtttcc ttctggcagt gaataccagg cttccagctt tgtctacgac
    3151  cagctgcatg tgcccttcca ctttactggg cgcactcccc gcgctttcgc
    3201  tagcaagggt gggaaggtat ctttcgtgct cccttggaac tctgtctcgt
    3251  ctgtgctccc cgtgcgctgg gggggggctt ccaagctctc ttctgctacg
    3301  cggggtctac cggcgcatgc tgattggggg actatttacg cctttgtccc
    3351  ccgtcctaat gagaagaaaa gcaccgctgt aaaacacgtg gccgtgtaca
    3401  ttcggtacaa gaacgcacgt gcctggtgcc ccagcatgct tccctttcgc
    3451  agctacaagc agaagatgct gatgcaatct ggcgatatcg agaccaatcc
    3501  tggtcctgct tctgacaacc caattttgga gtttcttgaa gcagaaaatg
    3551  atctagtcac tctggcctct ctctggaaga tggtgcactc tgttcaacag
    3601  acctggagaa agtatgtgaa gaacgatgat ttttggccca atttactcag
    3651  cgagctagtg ggggaaggct ctgtcgcctt ggccgccacg ctatccaacc
    3701  aagcttcagt aaaggctctt ttgggcctgc actttctctc tcgggggctc
    3751  aattacactg acttttactc tttactgata gagaaatgct ctagtttctt
    3801  taccgtagaa ccacctcctc caccagctga aaacctgatg accaagccct
    3851  cagtgaagtc gaaattccga aaactgttta agatgcaagg acccatggac
    3901  aaagtcaaag actggaacca aatagctgcc ggcttgaaga attttcaatt
    3951  tgttcgtgac ctagtcaaag aggtggtcga ttggctgcag gcctggatca
    4001  acaaagagaa agccagccct gtcctccagt accagttgga gatgaagaag
    4051  ctcgggcctg tggccttggc tcatgacgct ttcatggctg gttccgggcc
    4101  ccctcttagc gacgaccaga ttgaatacct ccagaacctc aaatctcttg
    4151  ccctaacact ggggaagact aatttggccc aaagtctcac cactatgatc
    4201  aatgccaaac aaagttcagc ccaacgagtt gaacccgttg tggtggtcct
    4251  tagaggcaag ccgggatgcg gcaagagctt ggcctctacg ttgattgccc
    4301  aggctgtgtc caagcgcctc tatggctccc aaagtgtata ttctcttccc
    4351  ccagatccag atttcttcga tggatacaaa ggacagttcg tgaccttgat
    4401  ggatgatttg ggacaaaacc cggatggaca agatttctcc accttttgtc
    4451  agatggtgtc gaccgcccaa tttctcccca acatggcgga ccttgcagag
    4501  aaagggcgtc cctttacctc caatctcatc attgcaacta caaatctccc
    4551  ccacttcagt cctgtcacca ttgctgatcc ttctgcagtc tctcgccgta
    4601  tcaactacga tctgactcta gaagtatctg aggcctacaa gaaacacaca
    4651  cggctgaatt ttgacttggc tttcaggcgc acagacgccc cccccattta
    4701  tccttttgct gcccatgtgc cctttgtgga cgtagctgtg cgcttcaaaa
    4751  atggtcacca gaattttaat ctcctagagt tggtcgattc catttgtaca
    4801  gacattcgag ccaagcaaca aggtgcccga aacatgcaga ctctggttct
    4851  acagagcccc aacgagaatg atgacacccc cgtcgacgag gcgttgggta
    4901  gagttctctc ccccgctgcg gtcgatgagg cgcttgtcga cctcactcca
    4951  gaggccgacc cggttggccg tttggctatt cttgccaagc taggtcttgc
    5001  cctagctgcg gtcacccctg gtctgataat cttggcagtg ggactctaca
    5051  ggtacttctc tggctctgat gcagaccaag aagaaacaga aagtgaggga
    5101  tctgtcaagg cacccaggag cgaaaatgct tatgacggcc cgaagaaaaa
    5151  ctctaagccc cctggagcac tctctctcat ggaaatgcaa cagcccaacg
    5201  tggacatggg ctttgaggct gcggtcgcta agaaagtggt cgtccccatt
    5251  accttcatgg ttcccaacag accttctggg cttacacagt ccgctcttct
    5301  ggtgaccggc cggaccttcc taatcaatga acatacatgg tccaatccct
    5351  cctggaccag cttcacaatc cgcggtgagg tacacactcg tgatgagccc
    5401  ttccaaacgg ttcatttcac tcaccacggt attcccacag atctgatgat
    5451  ggtacgtctc ggaccgggca attctttccc taacaatcta gacaagtttg
    5501  gacttgacca gatgccggca cgcaactccc gtgtggttgg cgtttcgtcc
    5551  agttacggaa acttcttctt ctctggaaat ttcctcggat ttgttgattc
    5601  catcacctct gaacaaggaa cttacgcaag actctttagg tacagggtga
    5651  cgacctacaa aggatggtgc ggctcggccc tggtctgtga ggccggtggc
    5701  gtccgacgca tcattggcct gcattctgct ggcgccgccg gtatcggcgc
    5751  cgggacctat atctcaaaat taggactaat caaagccctg aaacacctcg
    5801  gtgaaccttt ggccacaatg caaggactga tgactgaatt agagcctgga
    5851  atcaccgtac atgtaccccg gaaatccaaa ttgagaaaga cgaccgcaca
    5901  cgcggtgtac aaaccggagt ttgagcctgc tgtgttgtca aaatttgatc
    5951  ccagactgaa caaggatgtt gacttggatg aagtaatttg gtctaaacac
    6001  actgccaatg tcccttacca acctcctttg ttctacacat acatgtcaga
    6051  gtacgctcat cgagtcttct ccttcttggg gaaagacaat gacattctga
    6101  ccgtcaaaga agcaattctg ggcatccccg gactagaccc catggatccc
    6151  cacacagctc cgggtctgcc ttacgccatc aacggccttc gacgtactga
    6201  tctcgtcgat tttgtgaacg gtacagtaga tgcggcgctg gctgtacaaa
    6251  tccagaaatt cttagacggt gactactctg accatgtctt ccaaactttt
    6301  ctgaaagatg agatcagacc ctcagagaaa gtccgagcgg gaaaaacccg
    6351  cattgttgat gtgccctccc tggcgcattg cattgtgggc agaatgttgc
    6401  ttgggcgctt tgctgccaag tttcaatccc atcctggctt tctcctcggc
    6451  tctgctatcg ggtctgaccc tgatgttttc tggaccgtca taggggctca
    6501  actcgagggg agaaagaaca cgtatgacgt ggactacagt gcctttgact
    6551  cttcacacgg cactggctcc ttcgaggctc tcatctctca ctttttcacc
    6601  gtggacaatg gttttagccc tgcgctggga ccgtatctca gatccctggc
    6651  tgtctcggtg cacgcttacg gcgagcgtcg catcaagatt accggtggcc
    6701  tcccctccgg ttgtgccgcg accagcctgc tgaacacagt gctcaacaat
    6751  gtgatcatca ggactgctct ggcattgact tacaaggaat ttgaatatga
    6801  catggttgat atcatcgcct acggtgacga ccttctggtt ggcacggatt
    6851  acgatctgga cttcaatgag gtggcacgac gcgctgccaa gttggggtat
    6901  aagatgactc ctgccaacaa gggttctgtc ttccctccga cttcctctct
    6951  ttccgatgct gtttttctaa agcgcaaatt cgtccaaaac aacgacggct
    7001  tatacaaacc agttatggat ttaaagaatt tggaagccat gctctcctac
    7051  ttcaaaccag gaacactact cgagaagctg caatctgttt ctatgttggc
    7101  tcaacattct ggaaaagaag aatatgatag attgatgcac cccttcgctg
    7151  actacggtgc cgtaccgagt cacgagtacc tgcaggcaag atggagggcc
    7201  ttgttcgact gacccagata gcccaaggcg cttcggtgct gccggcgatt
    7251  ctgggagaac tcagtcggaa cagaaaaggg aaaaaaaaaa aaaaaaaaaa
    7301  aaaaaaaaaa