Sequence of DPV Rice virus X

Dianthovirus RVX1 ORF1, ORF2, ORF3, ORF4, ORF5 genes for 35 kDa protein, 54 kDa protein, 15 kDa protein, 28 kDa protein, 33 kDa protein, complete cds.

ACC No: AB033715

Dated: 2003-07-07 | Length: 4486 | CRC: 1638887533

                !!NA_SEQUENCE 1.0
ID   AB033715   standard; RNA; VRL; 4486 BP.
XX
AC   AB033715;
XX
SV   AB033715.3
XX
DT   06-JUL-2000 (Rel. 64, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 5)
XX
DE   Dianthovirus RVX1 ORF1, ORF2, ORF3, ORF4, ORF5 genes for 35 kDa protein, 54
DE   kDa protein, 15 kDa protein, 28 kDa protein, 33 kDa protein, complete cds.
XX
KW   .
XX
OS   Dianthovirus RVX1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RP   1-4486
RA   Miranda G.J., Aliyari R., Shirako Y.;
RT   ;
RL   Submitted (19-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Yukio Shirako, University of Tokyo, Asian Center for Bioresources and
RL   Environmental Sciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan
RL   (E-mail:shirako@ims.u-tokyo.ac.jp, Tel:81-3-5841-2678, Fax:81-3-5841-8036)
XX
RN   [2]
RA   Miranda G.J., Aliyari R., Shirako Y.;
RT   "Nucleotide sequence of a Dianthovirus RNA1-like RNA found in grassy
RT   stunt-diseased rice plants";
RL   Arch. Virol. 146:225-238(2001).
XX
DR   GOA; Q9IR21.
DR   SPTREMBL; Q9E9R0; Q9E9R0.
DR   SPTREMBL; Q9IR19; Q9IR19.
DR   SPTREMBL; Q9IR20; Q9IR20.
DR   SPTREMBL; Q9IR21; Q9IR21.
DR   SPTREMBL; Q9IR22; Q9IR22.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4486
FT                   /db_xref="taxon:106518"
FT                   /mol_type="genomic RNA"
FT                   /note="Dianthovirus RNA1-like genome"
FT                   /note="RVX1:Rice virus X RNA 1"
FT                   /organism="Dianthovirus RVX1"
FT   CDS             129. .1055
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IR22"
FT                   /transl_table=1
FT                   /gene="ORF1"
FT                   /product="35 kDa protein"
FT                   /protein_id="BAA97673.1"
FT                   /translation="MYPLDLVALIKRVQAWSPEKLFTWLWDVSARCVRAFVRWFWKAVD
FT                   YTGASRIIEHSFFEKTLPHVMEAEYNLRLLDQMEARNNAFRMASNVKTDGDSDSESSDE
FT                   EDDEELLRKNLERDIFADLLKDAKEQYKSHLEETRELEIIQARVKADNEEAARIESRYN
FT                   HHKAVDDCLEVLVYEANEAKNLQQISYLKSGKYDKCVKTVRPGCSVALIKSAIDMIRSR
FT                   HMVPDSSFNRIDEAAIRATALDFAASFNMDAKTTHIVVTGVVGICCLPDPKDIENIKVA
FT                   YHPKALQMRDLVSDLRASLPSFTPADF"
FT   CDS             1229. .2662
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9IR21"
FT                   /db_xref="SPTREMBL:Q9IR21"
FT                   /transl_table=1
FT                   /gene="ORF2"
FT                   /product="54 kDa protein"
FT                   /protein_id="BAA97674.1"
FT                   /translation="MIVSLEQRVFRVKKDGAFVRPPLPVPGAFNSCIAFRILWLAKLHS
FT                   EGPVLKSTVAEVVQCYTAEKRKLYEAAAQTLAWKPICRRDSHIRAFIKVEKLESDVKDP
FT                   VPRTIQPRSRRYNLCLGQYLRLNEKRFTRTIDLVFGEATVMSGYDNVTQARYLRSKWDS
FT                   YPDPVAIGLDASRFDQHCSPEALEFEHSFYTKVFNDPTLDELLSWQRVNKGTAVVMTGE
FT                   CLKYEVNGCRMSGDINTSLGNKLLMCAMVWTYLQAHDIDAKLANNGDDCVLFCSAGSVA
FT                   KIMSTLPGCFLNWGYTMEVEDPVRIFERTVFCRSQPVCVDGTWAMIRQLGSLSRDCFST
FT                   HDWSNEMTFRDNMNAIGQCNGIINDGVPVHMEQAKAMWRAGGSRNFNVETLRSQIEYSW
FT                   RERLGNRDRLLWSPVVPSTRLSYFLAFGIEPCVQEAVEAYLARVSLSAGGQTLPGLPRH
FT                   YSRIHKDLLRCRTANFFAS"
FT   CDS             2307. .2708
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IR20"
FT                   /transl_table=1
FT                   /gene="ORF3"
FT                   /product="15 kDa protein"
FT                   /protein_id="BAA97675.1"
FT                   /translation="MVLSTTEFLSTWSKQKRCGGLAAVAISMLKHCVARLSTVGENGWG
FT                   IEIGCFGAQWFQAHVCPTSLLSASNLVCKRRLRHIWPGCPFRPGDKPYQVCRAITHAFT
FT                   RIYYDVEPPTSSPVKRHEPWATRSRSQTP"
FT   CDS             2632. .3357
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IR19"
FT                   /transl_table=1
FT                   /gene="ORF4"
FT                   /product="28 kDa protein"
FT                   /protein_id="BAA97676.1"
FT                   /translation="MSNRQLLRQLNAMNLGQPAPARRRRRRQQPRVVVVQQAPPPPPRR
FT                   RRRNRRNTSAPDRYVGLGLSPAERSLLRGTQNSKVIITVEDSTEHITVTSDRVGQEPML
FT                   LGKWMRSTFERARVAAIEIRTQSVTPNGEPNDDSAARFVWQMGSQDLFCEWHHEHIVAN
FT                   TGPKDDDVWFFQPPADVAALEEHIDTSRLVVEGTFQLHLRIHYRQPAQFRVGTLHGGYT
FT                   RDPNTWMDNDNKTITATGR"
FT   CDS             3382. .4281
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9E9R0"
FT                   /transl_table=1
FT                   /gene="ORF5"
FT                   /product="33 kDa protein"
FT                   /protein_id="BAB11917.2"
FT                   /translation="METSRTYNLEAHKSKDCECEVSVSHHSTHAKSGKKQASKRASGSK
FT                   SSQTSVSTNTNIASRRQPGKQMVVPDHDASLDAVVPQLETLEISQVASRDSNRRRGSRR
FT                   SATPPSDDGLDTFSDTRSETRHTEGNWAQHPNAGSWSQLSLNEQHYEVATGTPVMPPNP
FT                   GPTQPRTRLPKTQVHVDGAGDVVTAPHADWDRYQAYLDRVKRDYGGIGFGNRPLVKSVN
FT                   GYAHMPNSTDILGHRHPMFIVWQQINCYGHVVKGLETIDGMFGIGWHFDLVFRNMKRIH
FT                   EYLEGVGCVPYHKLKDFA"
XX
SQ   Sequence 4486 BP; 1113 A; 1173 C; 1202 G; 998 T; 0 other;

 AB033715  Length: 4486  July 15, 2003 09:15  Type: N  Check: 3606  ..

       1  acaagcctta ccagcttgta agcctttcgc tcaatactcg gcgtgcaaac
      51  tgagatatag cgatttgtgc gtgcttcggc aacggtacct ttctgtgagg
     101  tcaaacagac gtgccaccac acgttaaaat gtatcccctg gatttggtcg
     151  ctttgatcaa gagggtccag gcgtggagcc cggaaaaatt gttcacctgg
     201  ctgtgggacg tcagtgcacg atgcgttcgt gcattcgtca ggtggttctg
     251  gaaggcagtt gactacactg gtgcatctcg tataatcgag cacagcttct
     301  tcgagaagac cctcccacat gtgatggaag ctgaatacaa cctccgcttg
     351  ctggatcaaa tggaggcgcg caacaacgcc ttcagaatgg ccagcaacgt
     401  caagaccgac ggagacagtg actccgagag ttctgacgag gaagatgacg
     451  aagagctgtt gcgcaagaac cttgagagag acatcttcgc tgatttgctc
     501  aaagatgcca aggagcagta caagtcacat ttagaggaaa cgcgtgagct
     551  cgaaattata caagcccggg tcaaggcaga caacgaggag gcagcacgta
     601  tcgagtcgcg gtacaatcac cacaaggcgg tcgacgactg cttagaggtg
     651  ctcgtgtacg aagcgaatga ggccaagaac ctccaacaaa ttagctacct
     701  caagagcggc aaatacgaca agtgcgtcaa gactgtacgc cctggttgtt
     751  ctgtcgcctt aataaagtca gccatcgata tgatccgcag ccggcacatg
     801  gtaccagata gttcgttcaa ccgcatagac gaggcggcca ttagggcaac
     851  agccctcgat tttgccgcgt cgtttaacat ggacgccaag accactcata
     901  tcgttgtcac aggagttgta ggcatttgtt gtcttcccga cccaaaggac
     951  atcgaaaaca tcaaggtggc gtatcatccc aaagccctgc agatgaggga
    1001  cttggtgagt gatctgaggg cgagtttgcc ctcgttcact cccgcggatt
    1051  tttaggtggc ccaatccgct tcctcccaac tgacacacca cataatcaat
    1101  tgcagttggc tgaggtgagg gtggcggaga aacgggcgag tgtcgttccg
    1151  aaggtgcgtt atgtgtacgg cctaccggcc ctctcggctg gcctgcacgt
    1201  gaccattcat aggccttcgt tgcataacat gattgttagt ttagaacagc
    1251  gtgtcttccg ggtcaagaag gatggagcat ttgtacgccc acctttgccg
    1301  gttccaggcg cgtttaactc atgcattgca tttcgcattt tgtggctcgc
    1351  aaagctgcat tccgaagggc ccgtgttgaa aagcacagtg gccgaagtgg
    1401  tgcagtgtta tacagcggaa aaacggaaac tttatgaagc agcggcgcaa
    1451  acattggcat ggaagccaat ctgtagaaga gactcacaca ttagagcttt
    1501  cataaaggtt gagaagctgg aatcagatgt caaggatccc gtaccgcgga
    1551  ccattcagcc gcgctcaagg aggtacaact tgtgcctcgg acaatacctg
    1601  cgcttgaacg agaaaaggtt cacccgcacc attgacctcg tgtttggcga
    1651  ggctacggtg atgagtgggt atgacaatgt cacacaagcc aggtacttgc
    1701  gaagcaaatg ggattcctat cctgatccag ttgctatagg tttggacgcc
    1751  tctagatttg accagcattg cagtcccgag gccttggaat ttgaacactc
    1801  attttacacc aaggttttca atgatcccac attagacgaa ctgctttcgt
    1851  ggcagcgagt caacaaaggg actgctgtag ttatgaccgg tgaatgtctg
    1901  aaatacgagg tgaacggttg caggatgagc ggtgatataa acactagtct
    1951  gggcaataaa ctgctgatgt gcgccatggt gtggacctac ttgcaagcac
    2001  atgatattga tgcaaaactc gctaataacg gcgacgactg cgtcctcttc
    2051  tgctctgccg gtagtgttgc caagatcatg agcacattgc ctggttgttt
    2101  tctgaactgg ggctacacta tggaagtgga agatcctgtg cgcattttcg
    2151  agaggaccgt gttttgtcgg tcgcaacccg tgtgcgtaga tggcacgtgg
    2201  gcaatgatcc gtcaactcgg gtctttgtca cgcgattgct tttccacaca
    2251  cgactggtca aatgaaatga cgttcaggga caatatgaat gctataggac
    2301  agtgtaatgg tattatcaac gacggagttc ctgtccacat ggagcaagca
    2351  aaagcgatgt ggagggctgg cggcagtcgc aatttcaatg ttgaaacatt
    2401  gcgtagccag attgagtaca gttggcgaga acggttgggg aatagagata
    2451  ggctgctttg gagcccagtg gttccaagca cacgtttgtc ctacttcctt
    2501  gctttcggca tcgaaccttg tgtgcaagag gcggttgagg catatctggc
    2551  cagggtgtcc ctttcggccg ggggacaaac cttaccaggt ttgccgcgcc
    2601  attactcacg cattcacaag gatttattac gatgtcgaac cgccaacttc
    2651  ttcgccagtt aaacgccatg aaccttgggc aacccgctcc cgctcgcaga
    2701  cgccgtaggc gtcagcaacc gagagtggtg gttgtccaac aggcgccccc
    2751  gcccccccct aggaggcggc gacgcaacag gcgtaacacc tccgcacctg
    2801  accgctacgt tgggctgggt ctcagtccag cagagaggag cttgttacgt
    2851  ggaactcaaa actccaaagt catcatcacc gttgaagatt caactgaaca
    2901  tattactgtc acctctgatc gcgtaggtca ggaacccatg ctacttggta
    2951  aatggatgcg ttccaccttc gagagggcac gcgtcgccgc tatcgaaata
    3001  cgcactcaaa gtgtcactcc taatggagag cctaatgacg attccgcagc
    3051  tagatttgtc tggcagatgg gcagtcaaga cctcttctgt gagtggcacc
    3101  atgagcatat agtggccaac actggcccga aagacgacga cgtgtggttc
    3151  tttcaacctc ctgccgatgt ggcggcgctt gaggagcaca tagacacctc
    3201  gcgcttggtg gttgaaggca ctttccagct tcacctgagg attcattatc
    3251  gccaaccggc acagtttagg gtcggcaccc ttcacggtgg gtacacccgt
    3301  gaccccaaca cgtggatgga taacgacaac aagaccatta cggccactgg
    3351  ccggtgagac aaaccatacc aggtttgaag catggagacc tcacgtactt
    3401  acaaccttga ggcgcacaag agcaaggact gcgaatgtga agtttccgtg
    3451  tcgcaccact cgacgcacgc taagagtggg aagaaacaag cgagcaaacg
    3501  tgcaagtggc agcaagtcat cccagacctc tgtttccacg aacactaaca
    3551  ttgcatcacg gcgtcaacct ggcaaacaaa tggtcgttcc agatcatgat
    3601  gccagccttg acgctgtcgt ccctcagctg gagactcttg agatttctca
    3651  ggtcgcctct agggactcta accggcgccg tggttcacgc cgcagcgcca
    3701  cgcccccgag tgacgacggc cttgatacct tcagcgacac cagatctgaa
    3751  accagacaca ctgagggcaa ctgggcccag caccccaacg cgggcagctg
    3801  gtcccagtta tcgctgaacg aacaacacta tgaggtggct acaggcactc
    3851  ctgtcatgcc gcccaaccca gggcccaccc aaccccgcac tcgtttgccc
    3901  aagacccaag ttcacgtgga cggggctggt gatgttgtca ccgcccctca
    3951  cgctgattgg gacaggtacc aagcttatct tgatcgagtc aagcgggatt
    4001  acggtggaat cgggtttgga aacagacccc tcgtcaagtc ggtgaatggg
    4051  tatgcccaca tgcccaactc caccgacata ctcgggcaca gacacccaat
    4101  gttcattgtc tggcagcaga tcaactgtta tggacatgtc gtcaagggat
    4151  tagagaccat cgacggtatg tttggcatcg ggtggcactt tgacttagtc
    4201  tttcgcaaca tgaaacgcat tcacgagtac cttgagggtg taggctgtgt
    4251  gccttaccac aaactcaagg actttgctta gagccaacgg gcgctatcct
    4301  cggcgcccta ataacctaag cgttggtaaa cgtgtggtca cgcatggtgg
    4351  tacggctctt cggagatgcg tagcttgcag cgtacacctt ggctggttac
    4401  ctaggtgtat ggcgatcacg tgaacccaac actaaaaatt aggctttgta
    4451  gacctccagc gccagagtat aacggctaag cacccc