Sequence of DPV Red clover necrotic mosaic virus

Red clover necrotic mosaic virus genes for 27 kDa protein, 57 kDa protein, 36 kDa coat protein, 88 kDa protein, complete cds.

ACC No: AB034916

Dated: 2006-06-04 | Length: 3890 | CRC: -349797427

                ID   AB034916   standard; genomic RNA; VRL; 3890 BP.
XX
AC   AB034916;
XX
SV   AB034916.1
XX
DT   16-NOV-1999 (Rel. 61, Created)
DT   04-JUN-2006 (Rel. 88, Last updated, Version 5)
XX
DE   Red clover necrotic mosaic virus genes for 27 kDa protein, 57 kDa protein,
DE   36 kDa coat protein, 88 kDa protein, complete cds.
XX
KW   .
XX
OS   Red clover necrotic mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RP   1-3890
RA   Mizumoto H., Hikichi Y., Okuno T.;
RT   ;
RL   Submitted (10-NOV-1999) to the EMBL/GenBank/DDBJ databases.
RL   Tetsuro Okuno, Kochi University, Laboratory of Plant Pathology and
RL   Biotechnology; Monobe 200, Nankoku, Kochi 783-8502, Japan
RL   (E-mail:okuno@cc.kochi-u.ac.jp, Tel:+81-888-864-5196, Fax:+81-888-864-5219)
XX
RN   [2]
RA   Mizumoto H., Hikichi Y., Okuno T.;
RT   "Red clover necrotic mosaic virus Canadian strain (RCNMV-Can) RNA1";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3890
FT                   /organism="Red clover necrotic mosaic virus"
FT                   /segment="1"
FT                   /strain="RCNMV-Can"
FT                   /mol_type="genomic RNA"
FT                   /note="Canadian strain"
FT                   /db_xref="taxon:12267"
FT   CDS             join(124. .831,834. .2426)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /ribosomal_slippage
FT                   /product="88 kDa protein"
FT                   /note="-1 ribosome frameshifting"
FT                   /db_xref="GOA:Q9QMG1"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QMG1"
FT                   /protein_id="BAA86872.1"
FT                   /translation="MGFVNFSLFDVDKLMVWVSKFNPGKILSAICNLGIDCWNRFRKWY
FT                   FGLNFDAHMWAVDAFMPLMPHYTEQMERVVGDLCSETLESKLEDCLELDTSVNQYFDEE
FT                   VYKEDDKGVMKLQRSAARKHIKRVRPGMMTAAIKAVETRIRNRHAIFGDNMGLIDEAAV
FT                   RATASDICGEFKINEHHTRTLVYTAAYLSMTPDQKSLDSVKLAYNPKSQARRTLVTAVR
FT                   ENKAVAGFKSLEDFGGPLSFPVEDAPYPILGIPEIRVAEKRASRVMRSKRVVGLPAVSA
FT                   GLKVCVHQTSLHNMIVSLERRVFRVKNAAGELVVPPKPIQNAFDSISYFREEWLRKLSH
FT                   KGQVLKSSIDDVVACYSSEKRKLYQKAADSLEKKPVQWRDSKVQAFIKVEKLECDTKDP
FT                   VPRTIQPRSKRYNLCIGQYLRLNEKKMLDSIDDVFKEKTVLSGLDNRAQGRAIAHKWRK
FT                   YQNPIGIGLDASRFDQHCSVDALKFEHTFYKACFPGDQQLEQLLKWQLSNTGSALLPTG
FT                   ELVRYRTKGCRMSGDINTGLGNKILMCSMVHAFLKEAGVRASLANNGDDCVLFCEKGDY
FT                   DEINRNLEQWFLCRGFEMTVEKPVDVLEKVAFCRSQPVCIATQWAMVRQLGSLSRDCFS
FT                   TQDWLNPKTFKDAMNALGQCNGIINDGVPIHMAQAKLMHKIGGNRKFNLDALHKQMEYS
FT                   WRDRLGKRTNLLWSEVEDATRLSYFKAFGIEPYIQKIVEEYFSQVEITCEGRSTNVLPA
FT                   HYSRIHKDLIKSR"
FT   CDS             124. .834
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="27 kDa protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QMG0"
FT                   /protein_id="BAA86873.1"
FT                   /translation="MGFVNFSLFDVDKLMVWVSKFNPGKILSAICNLGIDCWNRFRKWY
FT                   FGLNFDAHMWAVDAFMPLMPHYTEQMERVVGDLCSETLESKLEDCLELDTSVNQYFDEE
FT                   VYKEDDKGVMKLQRSAARKHIKRVRPGMMTAAIKAVETRIRNRHAIFGDNMGLIDEAAV
FT                   RATASDICGEFKINEHHTRTLVYTAAYLSMTPDQKSLDSVKLAYNPKSQARRTLVTAVR
FT                   ENKAVAGFKSLEDF"
FT   CDS             927. .2426
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="57 kDa protein"
FT                   /db_xref="GOA:Q9QMF9"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QMF9"
FT                   /protein_id="BAA86874.1"
FT                   /translation="MRSKRVVGLPAVSAGLKVCVHQTSLHNMIVSLERRVFRVKNAAGE
FT                   LVVPPKPIQNAFDSISYFREEWLRKLSHKGQVLKSSIDDVVACYSSEKRKLYQKAADSL
FT                   EKKPVQWRDSKVQAFIKVEKLECDTKDPVPRTIQPRSKRYNLCIGQYLRLNEKKMLDSI
FT                   DDVFKEKTVLSGLDNRAQGRAIAHKWRKYQNPIGIGLDASRFDQHCSVDALKFEHTFYK
FT                   ACFPGDQQLEQLLKWQLSNTGSALLPTGELVRYRTKGCRMSGDINTGLGNKILMCSMVH
FT                   AFLKEAGVRASLANNGDDCVLFCEKGDYDEINRNLEQWFLCRGFEMTVEKPVDVLEKVA
FT                   FCRSQPVCIATQWAMVRQLGSLSRDCFSTQDWLNPKTFKDAMNALGQCNGIINDGVPIH
FT                   MAQAKLMHKIGGNRKFNLDALHKQMEYSWRDRLGKRTNLLWSEVEDATRLSYFKAFGIE
FT                   PYIQKIVEEYFSQVEITCEGRSTNVLPAHYSRIHKDLIKSR"
FT   CDS             2428. .3444
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="36 kDa coat protein"
FT                   /db_xref="GOA:Q9QMF8"
FT                   /db_xref="HSSP:P11795"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QMF8"
FT                   /protein_id="BAA86875.1"
FT                   /translation="MSSKAPKKSKSRSQPRNRIPNTSIKTVAIPFAKTQIIKTVNPPQR
FT                   PAKALMHTQLVLSVVGTTQLRVNNGKSIQRFRLNPSNPALFPTIAYEAANYDMYRLKKM
FT                   TLRYVPIVTVQNSGRVSMVWDADSRDSAPQSRQETSAYSRSVSTAVYEKCSLTIPADNQ
FT                   WRFIADNTAVDRKLIDFGQLLFVTHSGSEGVEIGDVFFECEVEFKGPQPTATVIQKGVA
FT                   DVGGALSSEGPSYLMSSDLVVTPSGFGMNLDVAGTYLLTLVVAATASGNITVAGNSTLV
FT                   GEARAAYSSGNYIATLVFTSTGVLSATPSIQFTGSSGVTRVQLNLARCKPANTYVTG"
XX
SQ   Sequence 3890 BP; 1120 A; 857 C; 955 G; 958 T; 0 other;

ab034916 Length: 3890  04-JUN-2006  Type: N  Check: 4519  ..

       1  gaacaaacgt tttaccggtt tgtaaattgg aattctcgaa ttcgccagtc
      51  gccttcttcg tatcaaggat ctggaatttg aacggtatct ttatcatttt
     101  aatttctact tttcgtacca gtcatgggtt ttgtcaactt ttcgcttttt
     151  gatgtggaca aattgatggt atgggtgagc aaattcaatc caggcaagat
     201  attgtccgct atttgcaact tgggtataga ctgctggaac cgttttcgca
     251  aatggtactt cggtctcaac tttgatgcac atatgtgggc tgtcgatgcc
     301  tttatgccac tcatgccaca ttacacggag cagatggaac gcgtagtcgg
     351  cgacctctgc agcgaaaccc tagaatccaa attagaagac tgtctggaat
     401  tggacacttc cgtcaaccag tattttgacg aagaagtgta caaagaggat
     451  gacaagggcg tgatgaaact ccaaaggagt gctgccagga agcacattaa
     501  acgtgtgcga ccaggtatga tgacagcagc cataaaagct gttgagacga
     551  ggatcagaaa ccgccatgcc attttcggag ataacatggg attgatagac
     601  gaagctgcag ttagagcaac tgccagtgat atctgtggag agttcaaaat
     651  aaatgaacac cacacgagga cattggtata caccgcagca tatctttcca
     701  tgacacctga ccagaagtcc ctagacagtg tcaagctcgc ctataatcca
     751  aagagtcaag ccagaaggac tttagtgaca gccgttcgtg agaacaaagc
     801  tgttgctggg ttcaaatccc ttgaggattt ttaggcggtc cactcagctt
     851  tccggttgaa gatgccccat atcctatttt aggcatcccg gaaatcaggg
     901  tagctgagaa gcgggccagt agagtcatga gaagtaagag agtcgtaggt
     951  ttacctgctg ttagtgcggg tctaaaggtt tgcgtccatc aaacctccct
    1001  acataatatg atagttagtc tcgaacgcag agtgttccgt gtaaagaacg
    1051  ctgcgggaga gttagtagtg cctcccaaac caatccaaaa tgcatttgac
    1101  tccatttcct acttccgcga agagtggttg aggaaattgt ctcataaggg
    1151  tcaagtgctc aaatcctcca tagatgacgt tgttgcttgc tattcttctg
    1201  aaaagaggaa attgtatcaa aaagcggctg actctctgga gaagaaacct
    1251  gtccaatgga gagattccaa ggtgcaagca ttcatcaagg tagaaaaact
    1301  tgaatgtgac actaaggatc ccgtgccccg cacgattcaa cctcgatcca
    1351  agagatataa tctttgcata ggacaatatc tcaggttgaa tgaaaagaag
    1401  atgttggatt ccatagacga tgtcttcaaa gagaagaccg tcttgtcagg
    1451  tttggataac agggctcaag ggagagccat cgcccacaag tggcgcaaat
    1501  accagaaccc catagggatc gggctagatg cgagtagatt cgatcagcat
    1551  tgtagcgtgg atgccctcaa atttgaacac accttttata aagcgtgttt
    1601  tcctggggat caacagttgg aacaactatt gaaatggcaa ttatccaaca
    1651  ctggatcggc cctattacca actggagaac tggttagata ccgtaccaaa
    1701  gggtgtcgca tgagcggcga tataaacaca ggccttggga acaagattct
    1751  catgtgcagc atggtacacg cattcctgaa agaggcggga gtgcgggctt
    1801  cgttagccaa taatggtgac gattgtgtcc ttttctgtga gaagggagac
    1851  tatgatgaga taaaccgcaa tcttgagcaa tggttcctgt gcaggggttt
    1901  cgaaatgacc gtcgaaaaac ctgtcgatgt actcgagaag gtggcgttct
    1951  gtcgtagtca accagtttgc attgccacgc aatgggctat ggtaaggcaa
    2001  ttgggaagtt tgtctagaga ctgtttttca acacaggatt ggttaaaccc
    2051  aaagacattc aaagatgcaa tgaacgcgtt ggggcaatgt aacggaatca
    2101  tcaatgatgg agttccaata catatggctc aggcgaaatt aatgcataaa
    2151  atcggtggaa accggaagtt caatctagat gcactccaca agcaaatgga
    2201  gtacagttgg agagatcgtc tcggtaaaag aacgaatctt ttgtggagtg
    2251  aggtagagga tgctacgaga ttgtcatact ttaaagcatt cggcatagaa
    2301  ccttacattc agaaaatagt ggaggagtac ttctcacaag tggaaatcac
    2351  ttgtgagggg cgatcaacaa acgtattacc tgcacactat tctagaatcc
    2401  acaaagattt aatcaaatcc cgatagtatg tcttcgaaag ctcccaagaa
    2451  atccaaatca cggtcccagc ccaggaaccg gatcccaaac accagtatca
    2501  aaactgtagc catcccattt gccaagacgc aaatcatcaa gaccgtgaac
    2551  cctccacaaa ggccagctaa agctttaatg cacacccagc tggtactaag
    2601  tgttgttgga acgactcaac tgcgtgtgaa caacggcaag tccattcaga
    2651  ggttcagatt gaacccaagt aacccagctc tattccccac catagcctat
    2701  gaagccgcaa attatgacat gtatcgtctg aagaaaatga cactccgtta
    2751  tgtcccgatc gtgaccgtgc aaaattccgg acgcgtatca atggtttggg
    2801  atgccgactc tcgggattcg gctccccaat cacgacagga gacatctgct
    2851  tattctcgat ctgtctcgac tgccgtgtac gagaaatgct cgttgacgat
    2901  tccggctgat aatcaatggc gattcatagc tgacaacaca gccgttgata
    2951  gaaaactgat cgactttggc cagttgttgt ttgtcaccca ctccgggagt
    3001  gagggagtag aaattggtga tgtgttcttc gagtgtgaag tagaatttaa
    3051  aggaccccaa cccaccgcaa cagtcatcca gaagggtgta gctgacgttg
    3101  gcggggcact ctcctcagaa ggaccgtctt acttaatgtc ctcggactta
    3151  gtcgtcaccc cgtcgggttt cggtatgaac ttggatgtag cagggactta
    3201  tctgctaacg ttggtggttg cagcaactgc tagcggaaac atcacagtag
    3251  ccggcaattc aacattggtg ggtgaggcaa gggcagcata cagcagcggc
    3301  aactacatcg ccactctggt atttactagt accggcgtct tgtcggcgac
    3351  acctagtata cagtttacag gatcctccgg agttacacgg gttcaattga
    3401  acctcgccag atgtaaaccg gcgaatacct acgtcactgg ttagttggtt
    3451  aattggttag cgcagcctcc atccgagttg caagagagga agacgcagtc
    3501  tcgccgaccc tgttggcaaa cagtaaaatt gcaaaaaata gagtgttagg
    3551  agtagttccc atacccttgg ggacaagaac ctattatgga gaaacgaact
    3601  ggcatcggac cctgggaaac aggcatctag cgtattaata ggtcgctaga
    3651  agacgggcag gcttcaccac taggtaacct gccgccgaga gggaaaacct
    3701  ctgtgtggtt gtgcgcacgt cgttgtcgga agaagttcac catagtagtt
    3751  atttcctttt cttttaggta gaagcacttg ctccagaggg cgcatacctc
    3801  tggttaaaca aaattgtccc ctgagagtag aaaactcagg ttaataaaac
    3851  aggagaatat ttacctagtt gtataacggc taggtacccc