Sequence of DPV Red clover necrotic mosaic virus

Red clover necrotic mosaic virus genomic RNA (RNA2) for 35 kDa movement protein, complete cds.

ACC No: AB034917

Dated: 2003-07-07 | Length: 1456 | CRC: 1069156863

                !!NA_SEQUENCE 1.0
ID   AB034917   standard; RNA; VRL; 1456 BP.
XX
AC   AB034917;
XX
SV   AB034917.1
XX
DT   16-NOV-1999 (Rel. 61, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 3)
XX
DE   Red clover necrotic mosaic virus genomic RNA (RNA2) for 35 kDa movement
DE   protein, complete cds.
XX
KW   .
XX
OS   Red clover necrotic mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RP   1-1456
RA   Mizumoto H., Hikichi Y., Okuno T.;
RT   ;
RL   Submitted (10-NOV-1999) to the EMBL/GenBank/DDBJ databases.
RL   Tetsuro Okuno, Kochi University, Laboratory of Plant Pathology and
RL   Biotechnology; Monobe 200, Nankoku, Kochi 783-8502, Japan
RL   (E-mail:okuno@cc.kochi-u.ac.jp, Tel:+81-888-864-5196, Fax:+81-888-864-5219)
XX
RN   [2]
RA   Mizumoto H., Hikichi Y., Okuno T.;
RT   "Red clover necrotic mosaic virus Canadian strain (RCNMV-Can) RNA2";
RL   Unpublished.
XX
DR   GOA; Q9QMF7.
DR   SPTREMBL; Q9QMF7; Q9QMF7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1456
FT                   /db_xref="taxon:12267"
FT                   /mol_type="genomic RNA"
FT                   /organism="Red clover necrotic mosaic virus"
FT                   /strain="Canada"
FT                   /segment="2"
FT   CDS             103. .1044
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9QMF7"
FT                   /db_xref="SPTREMBL:Q9QMF7"
FT                   /transl_table=1
FT                   /product="35 kDa movement protein"
FT                   /protein_id="BAA86876.1"
FT                   /translation="MAVHFESLSDLAKTNDGVAVLLNRYTDWKCKSGGTETPLIPASVM
FT                   SKITDYAKTTAKGNSVALNYTHVVLSLAPTVGVGIPGHVIVELINPNVDGPFQVLSGQT
FT                   LSWSPGSGKPCLMIFSVHHQLNSDHEPFRVRVTNTGIPSKKSYARCHAYWGFDVGTRHR
FT                   YYKSEPARLIELEVGYQRTLLTSIKAVEAYVQFTFDTSRMENNPQLCTKSRMNVIPPKV
FT                   EAFPIRGIAPPLSVVENRKVPKRKGGNGNQSIKLPPLGQVLSPSSALSMKQGTHRNIAN
FT                   RSNPIKRNQDDNWLGEHLSEKGRVTDPNLEPL"
XX
SQ   Sequence 1456 BP; 423 A; 320 C; 352 G; 361 T; 0 other;

 AB034917  Length: 1456  July 15, 2003 09:21  Type: N  Check: 7424  ..

       1  gacaaacctc gctcttaaag aaaaattgat cctgaaccgc gtaaagtttt
      51  aaaactacgg acaattaagg agttgtgaca agacgactca ggtggtttgc
     101  agatggctgt tcacttcgaa agcttgtctg atttggctaa gacaaatgat
     151  ggagtagcgg tattattgaa ccgttatact gattggaaat gtaagtccgg
     201  ggggacagag actcctctca tacctgccag tgtaatgagt aagatcaccg
     251  actacgccaa gactactgcc aaaggaaaca gtgttgcgct aaattataca
     301  cacgtagttc tatcgcttgc accaacagta ggtgtaggta ttccaggaca
     351  cgtaatcgtt gaattaatca atccgaatgt agatggacca tttcaagtct
     401  tgagtggcca gacattgtct tggtctccgg ggtccggcaa accctgcctc
     451  atgatatttt cagtccacca ccaactcaac tctgatcacg agccctttag
     501  ggtgcgagtc accaacacag gaatcccttc gaagaaatca tatgcaagat
     551  gccacgcgta ttggggattt gacgtaggta ctcgtcatcg ctattacaag
     601  tcagaacctg cgcgtctgat tgagttggaa gtaggatatc aacgaacgtt
     651  actgacgagc attaaagcgg tagaagcata cgtacagttt acctttgaca
     701  caagcaggat ggagaacaat cctcaattgt gtaccaaatc tagaatgaat
     751  gtcatccctc ccaaagtaga agcattccca atcagaggta tcgccccgcc
     801  tctcagtgtt gtggaaaacc ggaaggtgcc gaaacggaaa ggaggaaacg
     851  gtaaccaatc aataaagttg ccgccgttgg gacaagttct tagtcccagt
     901  tctgctttga gtatgaagca gggaactcac agaaatattg cgaacagatc
     951  taatccgatt aaacgtaacc aagatgacaa ttggttaggt gaacatcttt
    1001  ctgaaaaggg ccgggttacc gacccaaacc tggaaccact gtaactcagc
    1051  caggggaatt cagacgaatg tccactgaaa atgtcaaatc caatatagag
    1101  tacagaagag aaggagaatt gctttggctt cggcggaaga cgaaatggtt
    1151  taagtacagg ctacgagttc tcctcgtagg gtctctcttt ctcggccttc
    1201  ggtgggcttt atcttgggtt tacatctaca gcgttggacc atggatcttc
    1251  ttcggctaag tcaagtagtc tgcgatagct gcttgcttgg gttgattttc
    1301  tgtgattatg ggggggttgg acccctctgg tgtgagaaga aaacacatca
    1351  tatcaaaaaa cagggttctg taaccggtgc gacaatatgc ccttccaagg
    1401  cactgaccgg cacggataaa agctatttgc ctagtcgtat aacggctagg
    1451  cacccc