Sequence of DPV Citrus tristeza virus

Citrus tristeza virus genomic RNA, complete genome, seedling yellows strain.

ACC No: AB046398

Dated: 2005-04-14 | Length: 19302 | CRC: -322116923

                !!NA_SEQUENCE 1.0
ID   AB046398   standard; genomic RNA; VRL; 19302 BP.
XX
AC   AB046398;
XX
SV   AB046398.1
XX
DT   30-NOV-2000 (Rel. 66, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Citrus tristeza virus genomic RNA, complete genome, seedling yellows
DE   strain.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19302
RA   Natsuaki T.;
RT   ;
RL   Submitted (19-JUL-2000) to the EMBL/GenBank/DDBJ databases.
RL   Tomohide Natsuaki, Utsunomiya University, Faculty of Agriculture;
RL   Mine-machi 350, Utsunomiya, Tochigi, 321-8505, JAPAN
RL   (E-mail:natsuaki@cc.utsunomiya-u.ac.jp, Tel:81-28-649-5449,
RL   Fax:81-28-649-501)
XX
RN   [2]
RA   Suastika G., Natsuaki T., Kano T., Ieki H., Okuda S.;
RT   "Nucleotide sequence of citrus tristeza virus seedling yellows strain";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19302
FT                   /country="Japan"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NUagA"
FT                   /strain="seedling yellows strain"
FT   5'UTR           1. .106
FT   CDS             107. .9505
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTG5"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="UniProt/TrEMBL:Q9DTG5"
FT                   /transl_table=1
FT                   /function="replicase"
FT                   /gene="p349"
FT                   /product="349-kDa polyprotein"
FT                   /protein_id="BAB18522.1"
FT                   /translation="MSKLGARFKSSTFAVRSDYIISRIWRVFNTVGVLHFFGTETTTKV
FT                   VKEFSAPMPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVIDTSGVVRPR
FT                   SVAGIWRYSLCKPPLSAAAKKSIGKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVMK
FT                   RVDTTMHESPQDEIKCKGRRHGKNSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIT
FT                   FGALPTTAWCSPDDAAVLRCRLDYHAAETSFRNEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CAGVFPSGSALGVEVPSVRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVCYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYRKSLGARVHCLWESSDLDDAKV
FT                   RDGQCYIRHVYDVALYFGRRVDLSVRRTLGMYPTVGALKAYLVREYGRESLKVPMRGTY
FT                   TFGSVFHCLSTKSFVDLRSIPNHHLVGGASAHVFIGQIRVDVPGGVSKPSRAAVRRRNR
FT                   RLREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSIVGPTLGRIPSINRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRAPPVG
FT                   SFLPCFVKRGVTLRLGSLCRASRYEHHYDASIERRGLSWVRKSGFRMVEVNTPVERSRT
FT                   GRFLWLAFRTEFTGLILTNPSGILFKQLPVSGENSPIRLRGASSPRTLISWLKGSGLGI
FT                   KVGSPSHHLECAARGQRSTWNGGKIWGISVFPSSTVYNARVDERCLNKRVLKLRDTSAS
FT                   SFLRIVFLARLSSYRPSLSDGEFLNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPF
FT                   GVYLYTRHAFDIYSGKLLQLDSYGFSEDLKDGYCYIRHIAEVCLSMGKIFFRRDVNLGA
FT                   FPHVFEVQHRLERLYGKRAVEYGVRGYFSATRLFHCCFTDSPRPFKSLNKYHKMGGEEG
FT                   ALLITDTDRLRAVGSAYEKVKGRLPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQ
FT                   MSENQQVMLTRAYPEFNINFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLF
FT                   HLRAGHTGVHVCRPVYDIKDAHRRVVRHHQLSKVAFDHTDGSKQVGAVNTNTVCGNVLG
FT                   ECFHASDAIVMVQVYDVPLRELCRAMVNKKASVCYMTVVTPGELLDARESFFIKELDCS
FT                   VELDAVADRVVYCFNNSAYTHTYSTICEYMRTPCVVVDGFLFTIEMVSLRCSVNYYCIT
FT                   KSRVCPRISEIKRLRYRRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYV
FT                   VNNCVVVNAKTFEWTWNYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGR
FT                   QNAEAFSRRLAAFSGDTSLFELVRFAISEKCRDLFVGIQEAVERCVKSYLRNSFNMSFV
FT                   DLSDPLLTISEYSELDVPIDLPGFGCIAEEDEAKLIEDGVKSALLRKAVRDEAQLILER
FT                   GGTSEIVSCGDEESLGGDGSDSLLGSGSDSPSNASSGGLRAGAAPSLFRSLLKKLGGGF
FT                   CMAKRLLDLLCERLVASLSRLKFGTTHLTSFFSVLRVNVSRNFFDDSIFAAVWDTVMNL
FT                   IRIVNGVTKTKLECFRNVLRLIPKLCSGCKDLAKDFADMCRLVFLLSTEFFSKSYAKLC
FT                   RFSLEIFDIGLIEISARNMGLETCVSMASAIFDVILTYPLGSVSFPIVCRRVFGALPME
FT                   VGSNYCFKKTFGKPEILGEDAFRRTCKYGVEAKAFDKLSVDGKGLVRCSGVIPGILRIV
FT                   FSSLFSDADAWVGYSKHEVSSLPIITFSAKRLSFVLERTKEACIAFIVDSSKKILASLT
FT                   SEIHESFQNSELTSGAKSLYGHVSSILSASNGVVNKAGSAVAAVKAAGSGLSKRVRRIR
FT                   PSFRLARCVNEQTSEYYSASDESELDESLLSDTPGLRGNGKCSDLFRVVSGRVSVCCRH
FT                   AVEALRRLALHVGDYLYSCIMDSFVRLFVRTNTAVGKCESFAVDCATKISDLVVGCIAW
FT                   RNLHSGAYSTTPGLSGGSRNSLSRFLDGGLMVCNSKFWYRVADRFSMRPLLSLAHRMRT
FT                   ASINVLLEFLKNLPVCLISIYTFIECRSRIFPLKEFLWGFCVFVWNIVKELSICIYGSL
FT                   PVCVTRLCNRAFRRSSNEGDVGTLQVITEAENRIEFLREVLAEMARYRASLEIPVPGSP
FT                   DSPLFPPTYGEIEELGNDSSDSARLIGVDNGSDSVPTEGDRELDSDGDSDDSIPLDRDF
FT                   EQIGGLGGDGNVDVFRLGLRFVWRMLRNLFNLRAVKFSYGLALQCIFNGGSNGQFTSRL
FT                   LFSFRQTVYPFEFFRHVCSVRWLSKSLALHVRNRLICDEETVERFFSFSRFLYDSRYLS
FT                   DVFSVLERVDFYLSYLFSLPKRCLTRNRSVRVCARAPVRVIRGAGLVEDGKKSLTEVLN
FT                   SLDSLKVSDRKGKSALIESDNSDSESGHSFGSISFGSVNEEVLEAVNGGVVSEKAPLMK
FT                   HAAALSRLEPDLSGNKDLPIVRRSFTRGESSGTKPAESLCVYLTTLNSSFGSVPDLYPV
FT                   ARDITYKKLTNAMREFYYSQKVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVSVV
FT                   DFNLKVIVGRHGTRPFRNTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFL
FT                   RAVDGRDLTFTNSEHSLIVYEAPPGGGKTHSLVKYFADYCTKVSCLVVTANKNSQAEIS
FT                   QRISKELMDRKMLAKHVVKTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVV
FT                   EFTSCKAVVFFGDSRQIHYIHRNDFGVSLLHDIDAFIEPQHRVYGEVSYRCPWDICEWL
FT                   SKFYPRHVATANTGSIGKSSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLT
FT                   VGRTKAVPIVNTVHEVQGETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVL
FT                   NSRRYDKTASSIDEAREIFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCIN
FT                   EFLNEVVVGSSVVQLGDISEELSSRPFESGCDNITVRDTAPPDSGNLHEPARVRRGKVA
FT                   SNSAKKSVPTRKSSVVRKS"
FT   CDS             <9429. .10862
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTG4"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9DTG4"
FT                   /note="p54; probably expressed via +1 ribosomal
FT                   frameshift."
FT                   /transl_table=1
FT                   /function="replication"
FT                   /gene="p54"
FT                   /product="54-kDa RNA-depended RNA polymerase"
FT                   /standard_name="RdRp protein"
FT                   /protein_id="BAB18523.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPENFGRAM
FT                   AAAVIERCFRMDEVAKIRSDIIALTEANIQKWLDKRTPCQVKSVQAELKLPFDVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIYSPCFDEFKNRVLSSLNGNIV
FT                   FFTEMTNAGLAEVIRRIIGDDDNLFVGEVDFSKFDKSQDLFVKEYERALYSEFGFDDEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPKYKLTDDELFELFTSFKDITQDFGDQVVLEKLKLLVETKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLICERVVYDNRVGYFSYFD
FT                   NPFAKPDASDGQADGLATG"
FT   CDS             10911. .11822
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR010803"
FT                   /db_xref="UniProt/TrEMBL:Q9DTG3"
FT                   /transl_table=1
FT                   /function="unknown"
FT                   /gene="p33"
FT                   /product="33-kDa protein"
FT                   /protein_id="BAB18524.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKT
FT                   VDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENL
FT                   NNVCSSSFFFRAVSETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLG
FT                   DSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLSIIFI"
FT   CDS             11892. .12047
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009584"
FT                   /db_xref="UniProt/TrEMBL:Q9DTG2"
FT                   /note="p6; a small hydropobic protein"
FT                   /transl_table=1
FT                   /function="unknown"
FT                   /gene="p6"
FT                   /product="6-kDa protein"
FT                   /protein_id="BAB18525.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHVTV"
FT   CDS             12053. .13837
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTG1"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="UniProt/TrEMBL:Q9DTG1"
FT                   /note="p65; CTV encoded homolog of HSP70 family of heat
FT                   shock proteins"
FT                   /transl_table=1
FT                   /function="chaperon"
FT                   /gene="p65"
FT                   /product="65-kDa heat shock protein 70 homolog"
FT                   /protein_id="BAB18526.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFFKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYTCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDALLADLRKTEILSEYSKKYPITRNDIDVPSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13761. .15371
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProt/TrEMBL:Q9DTG0"
FT                   /transl_table=1
FT                   /function="unknown"
FT                   /gene="p61"
FT                   /product="61-kDa protein"
FT                   /protein_id="BAB18527.1"
FT                   /translation="MCLHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRSQNLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGVEDRKIPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDTYKTMVFT
FT                   KTFDSGVFGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   YTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   TLVPFDPTDFVLDIPKLNIHDTMVVVGNQIRHLEHVVESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAVDRVVERPALFNLPRKLLNQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLKFPPISSVRLPAHHGYLYVDFYKRIPDN
FT                   AVDADELESLRQLRSSVDVMCKDRVSITPPPFNRHRRGSSRILRGRGAAGASSRYMSRD
FT                   VATSGFNLPFHHGGLHDAS"
FT   CDS             15346. .16068
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTF9"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q9DTF9"
FT                   /note="p27; a diverged copy of the coat protein that exists
FT                   at one end of virion"
FT                   /transl_table=1
FT                   /gene="p27"
FT                   /product="27-kDa divergence coat protein"
FT                   /standard_name="CPd"
FT                   /protein_id="BAB18528.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRQVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16160. .16831
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTF8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q9DTF8"
FT                   /note="p25; CTV coat protein"
FT                   /transl_table=1
FT                   /gene="p25"
FT                   /product="25-kDa coat protein"
FT                   /standard_name="CP"
FT                   /protein_id="BAB18529.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16797. .17300
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR008452"
FT                   /db_xref="UniProt/TrEMBL:Q9DTF7"
FT                   /note="p18, a protein having no homologs in other
FT                   closteroviruses"
FT                   /transl_table=1
FT                   /function="unknown"
FT                   /gene="p18"
FT                   /product="18-kDa protein"
FT                   /protein_id="BAB18530.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGTFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17334. .17693
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009692"
FT                   /db_xref="UniProt/TrEMBL:Q9DTF6"
FT                   /note="p13, a protein having no homologs in other
FT                   closteroviruses"
FT                   /transl_table=1
FT                   /function="unknown"
FT                   /gene="p13"
FT                   /product="13-kDa protein"
FT                   /protein_id="BAB18531.1"
FT                   /translation="MGIRRVWLKIMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESRADRANVSEIVESHVSDRDRMKILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17769. .18317
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProt/TrEMBL:O10477"
FT                   /transl_table=1
FT                   /function="unknown"
FT                   /gene="p20"
FT                   /product="20-kDa protein"
FT                   /protein_id="BAB18532.2"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18400. .19029
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProt/TrEMBL:Q776R6"
FT                   /note="putative RNA-binding protein"
FT                   /transl_table=1
FT                   /function="unknown"
FT                   /product="23-kDa protein"
FT                   /protein_id="BAB18533.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           19030. .19302
XX
SQ   Sequence 19302 BP; 4755 A; 3807 C; 4911 G; 5829 T; 0 other;

AB046398  Length: 19302  April 19, 2005 08:53  Type: N  Check: 3691  ..

       1  aatttctcaa attcacccgt accctccgga aatcacgtcc ggacgctgcg
      51  ggaatcggtg taaatccggc aaattgcctc actacgccca tacaaacaat
     101  cataatatgt cgaaactcgg agctcgcttc aagtcctcga ctttcgctgt
     151  acgcagcgat tacatcatct cgcgcatctg gcgcgtcttt aacaccgttg
     201  gagtcctgca cttcttcggt actgaaacaa ccaccaaggt ggttaaggag
     251  ttttcggctc ctatgccgat agtcccttta cggaaatcct gttttccgtt
     301  ttctgttcgc gctgctgttc gcgcgattaa agctgccgga cgtcctattg
     351  acgctccgcg ctccggatgc ctctgtggcc tccctgttat cgacacatct
     401  ggtgtcgtac gtccccgctc tgtcgcgggc atttggaggt attctctgtg
     451  taaacctccc ctctctgccg ccgccaagaa gtccattggc aaggcgaaga
     501  aagattctgc tttctttctt agccgggctt cttctctctt ttcacgggag
     551  gtcccttgcg gcacgcgtca cagacttcgc aggcgcgtta tgaaacgagt
     601  agacaccacc atgcatgaga gtccccaaga cgagatcaaa tgtaagggac
     651  gccgtcatgg caaaaattct gacctcccgt atatggggga agcagcgttg
     701  gatgatatcc ttcgctggat tgagggggta aatcccccgc cgtcgatggt
     751  cgccattccg gtgcccatca cttttggcgc tttgcccacg acggcttggt
     801  gctcccctga cgatgctgct gttttgcggt gtcgcctgga ctaccatgct
     851  gctgagactt cctttcgtaa cgaagggaag catgtgaggt acgtctataa
     901  tgacgtatct tctgctgcta accgtcctcg tacggtttct ccccgcaagt
     951  gcgcgggtgt tttccccagc ggttctgcgc tgggtgttga ggtcccgagc
    1001  gttagggatc gccacaccgc ttttgtgaga tctactcacg ctagcgtttt
    1051  cttttctgac gcggttcgcc gcgttcgtat gttccgtcct gggcggaaca
    1101  atttctttac tagcgtcgtc agtgggcggc gcgtttgcta cttcagaccc
    1151  ggacctaatg gtacggtgtc tgtcttaatg tccgatggcg ttaatacggc
    1201  ccgtcttgac gtcgtcgcac ccgcgtacta tgcgtaccgt aaatcgttag
    1251  gcgccagagt gcactgtttg tgggagtcgt ctgatttgga cgacgctaag
    1301  gtacgtgacg gtcaatgcta tattcgtcac gtgtatgacg tggcccttta
    1351  ctttgggagg cgcgtcgatc tttctgtgcg ccgcacttta ggcatgtatc
    1401  ccacagtggg tgcattaaag gcttaccttg ttcgcgagta tggtcgcgaa
    1451  tctttgaagg ttccgatgcg cgggacttac acttttggca gtgtatttca
    1501  ttgcctgtcg actaaatctt ttgtcgactt gagatctatt cctaaccatc
    1551  acttggttgg tggtgcgtct gctcacgtgt ttattgggca gattcgtgtt
    1601  gatgttcctg gtggtgtctc taaaccatca cgagcagctg ttcgcaggcg
    1651  taataggcgt ttgcgtgaag acgggttttt aggtagtacc gattcgtctt
    1701  cttcaggagg gtcgagatac tgttcggatt gttcaactcc tcgcagtccg
    1751  ccctctccgt cgattgttgg accaactctt ggccggatac caagtataaa
    1801  ccggaagttc cggtttccag caggcactca gttgagtgtt tctatcccta
    1851  aacgcgatga cgatcgcgtg tacgtgtcgg tcggccaaga ctttgatgag
    1901  ttgtgccatg ccgtgtgtac ctacgttaag aggtacaact cgagaaaagc
    1951  gttttacacg cggtttgaaa atggtgatga tttcgccgtc attcgggccc
    2001  ctcccgtcgg atcctttcta ccgtgtttcg tgaaacgcgg ggtaacttta
    2051  cggctcggtt ccctatgtcg ggcttcaagg tatgaacatc attatgatgc
    2101  aagtattgaa aggcgcggtt tgtcgtgggt gcggaagtcc ggtttccgaa
    2151  tggttgaagt taatacgccc gtcgaaagga gtcggacggg gcggtttctt
    2201  tggctagctt tccggaccga atttaccgga ttaattctga ccaacccgtc
    2251  cggaattctg ttcaagcagc ttccggtgtc gggtgagaat tctccaatcc
    2301  gtctccgagg agcgtcttcg ccccgaacgt tgatttcttg gttgaagggg
    2351  tccgggcttg gtataaaggt tggttctcct agtcatcacc tcgagtgtgc
    2401  cgctcgtggg caacgttcca cctggaacgg gggaaagatt tgggggattt
    2451  cagttttccc gagtagcacc gtgtacaatg cacgtgtaga cgagcggtgc
    2501  ttaaataaac gtgtcttgaa attgcgggac acgtcggcgt cctcttttct
    2551  tcgtatagtt tttttggctc gtttgtcgag ttatcggccc tctttaagtg
    2601  acggggagtt ccttaacaag tgcgttactt ctcggtttgt agcttgtatc
    2651  gaggcggttg aatccggtct cgttacggta cactttcgat ccgacgtgtt
    2701  tcgcgcctcg ttcccgtttg gcgtttattt gtatactcgt cacgcatttg
    2751  atatttacag tggtaaactc ctgcaactag atagctacgg gttttcggaa
    2801  gacctgaagg acggctactg ttatattcgt catattgctg aggtctgttt
    2851  gagtatggga aaaattttct ttaggaggga cgttaactta ggggcgtttc
    2901  ctcatgtttt tgaggtacaa caccgtcttg agcggttgta tggtaagcgg
    2951  gctgttgaat acggcgttag agggtatttt tcagcaacgc gtcttttcca
    3001  ctgttgcttt accgattcac cgagaccctt caaatcttta aataagtatc
    3051  ataagatggg tggtgaagaa ggtgcgttat taatcactga caccgataga
    3101  ttacgtgccg tggggagtgc ttacgagaag gtgaaggggc gtttgcctga
    3151  ttctttactc gttcgatcag tggagaaaga tttgatagaa ttcaatcaaa
    3201  ctctggttga tacgcaacgg gctagacccg gtgttgcggt gccttttcag
    3251  atgagtgaga accaacaggt gatgctcact agagcttatc ctgagtttaa
    3301  tataaacttt actcattccg tacactccga tcaccccgtc gctgcgggtt
    3351  ctagaatgtt agagaatcac cttgttcgta aatacgcagg tagcgattat
    3401  tcggacgtag gtggttgccc attatttcat ttacgtgcgg gtcatacagg
    3451  agttcacgtt tgcagaccag tgtacgatat taaagacgcc caccgtagag
    3501  tcgttcgtca tcatcaactt agtaaagtag cttttgatca tactgacggg
    3551  tctaagcaag ttggtgctgt caatacgaac accgtgtgcg gcaacgtttt
    3601  aggggagtgt ttccatgcgt ctgatgcgat tgttatggtg caagtttatg
    3651  acgtgccatt gcgagaattg tgtagagcta tggtgaacaa gaaagcttcg
    3701  gtgtgttata tgaccgtggt tacgcctggt gagttgttgg acgcccgtga
    3751  gtccttcttc atcaaagagt tagactgttc ggtggagttg gacgctgtcg
    3801  ccgatagggt tgtttactgc tttaacaatt cagcgtatac gcatacctat
    3851  tctacgatat gcgaatacat gcgtactcct tgtgtggtgg tggatggttt
    3901  tctgttcact atagagatgg tttcactcag atgtagcgtt aactattatt
    3951  gtatcaccaa atcgcgggtt tgtccgagaa tcagcgagat taaacggtta
    4001  cgctatcgtc ggtgtgacag tgacttgatt agaattaaga tacctcggta
    4051  ctctagtaag actcgtagtt gtttaccagg gtgctattac ttgtatttgg
    4101  acgctaagtt tgtgagtcgt gtgtacgaat acgtggttaa taattgtgtt
    4151  gtggtgaatg ctaagacttt tgaatggact tggaactaca tcaagtcctg
    4201  taagtcgaga gtggtcatca gtgggaagat catccatagg gacgttccta
    4251  tcgcattaga gtacttggat gggttttccg cagttatgct gtccgcgggc
    4301  gtgaaaggta ggcagaacgc agaagcgttt tctaggcgtc tagcggcctt
    4351  ttcaggagac acttctcttt tcgaattggt gaggttcgcc atttcagaga
    4401  agtgtcgcga tttatttgtg ggcattcagg aggctgtgga gagatgcgtg
    4451  aagtcatacc tcagaaactc gtttaatatg agtttcgtag acttgtctga
    4501  tcctctgctc acaatcagtg agtactcgga gttagatgtt cctattgatt
    4551  taccgggttt cggctgcata gcggaggaag acgaggctaa actcatagaa
    4601  gatggagtta agtcagctct actgcgaaaa gcagttcgtg acgaagcaca
    4651  actcattctc gaaaggggcg gcacgtcaga gatcgtttcc tgtggggatg
    4701  aagaaagttt aggcggcgac ggttctgaca gtttactcgg gtccggtagt
    4751  gattcgcctt ctaacgctag ttctggtggt ttgcgggccg gagctgcccc
    4801  ttcactgttt agaagtttgt tgaagaagtt gggtgggggt ttttgcatgg
    4851  ccaaaaggtt gttggacttg ttgtgcgagc gattagttgc ttcgttatcg
    4901  cgcctaaagt tcggtacaac tcatttaacc tcattcttta gcgtgttacg
    4951  tgttaacgtt tcgcgtaatt tcttcgacga ctcgattttt gccgctgttt
    5001  gggacacagt aatgaacttg attagaatcg tcaatggggt gaccaagacg
    5051  aagttggagt gttttcgcaa cgtacttcgg ttaattccta agctgtgttc
    5101  tggttgtaag gacctcgcga aagactttgc ggacatgtgt aggttagttt
    5151  ttctgctttc tacggagttt ttcagtaaaa gctacgctaa actatgtcgg
    5201  tttagtttgg aaatattcga tatcggactt attgaaattt cggcccgtaa
    5251  tatgggacta gagacttgtg tttcgatggc ttcggctatt tttgatgtta
    5301  tacttaccta tcctctggga agtgttagct ttcctatcgt ttgccggagg
    5351  gttttcggcg ccctccctat ggaagtagga tcgaactatt gttttaagaa
    5401  aactttcggc aaacctgaaa ttttaggaga ggatgctttc cgtagaacgt
    5451  gtaagtatgg tgttgaggct aaggctttcg acaaactttc ggtcgacggt
    5501  aagggtttag ttaggtgttc cggtgttata cctggaatac tgaggatagt
    5551  gttttcgtct ctattttccg atgccgacgc atgggtaggt tatagtaaac
    5601  acgaagtttc ctcgcttccc ataattacgt ttagcgcgaa aaggttgtct
    5651  ttcgtgctgg agcggactaa ggaagcgtgc atcgctttca tagtcgattc
    5701  gtctaagaag attttagcat ctttgacctc agagattcac gagtctttcc
    5751  aaaactcgga attaactagt ggtgctaaat ccttgtatgg acatgtgagt
    5801  tctatactct cagcgtccaa tggtgtagtt aacaaggcag ggagcgccgt
    5851  tgcagcggtt aaagcggcgg ggagtggtct tagcaaacgt gtgaggcgca
    5901  ttcggccttc cttccgcctt gctcggtgtg ttaatgaaca gaccagcgaa
    5951  tactactctg ctagtgacga gtctgagttg gatgagtcgc tgcttagtga
    6001  cacacccggt cttcgtggta acgggaagtg tagcgatttg tttcgtgtcg
    6051  tttctggacg tgtctcagta tgttgtaggc acgctgtgga agccttgagg
    6101  cgtttagccc tacacgtcgg tgactacttg tactcgtgca ttatggactc
    6151  ttttgtgagg ttgttcgtaa gaaccaacac tgcagtcggg aagtgtgaat
    6201  ccttcgccgt cgattgtgcc actaagattt ctgatttggt agtcggatgt
    6251  attgcttggc gcaatcttca ttccggtgcg tattcgacaa ctccaggatt
    6301  atccggcggc agtagaaatt ctctttccag gttcttggac ggcggtctca
    6351  tggtgtgtaa ttcaaaattt tggtaccgcg tggcagaccg gttttcaatg
    6401  agacctttat tgagcttggc ccatcggatg aggactgctt cgataaatgt
    6451  gttgctagag ttcctgaaga acctcccggt ttgtttaatt tcgatataca
    6501  ctttcataga gtgtagatct aggatttttc ctttgaagga gtttctttgg
    6551  ggcttttgcg tttttgtttg gaacattgtt aaggaacttt ccatatgcat
    6601  ttacggaagt ctccccgttt gcgttacgag gttgtgtaat agggcgttcc
    6651  gtcgcagttc caacgaaggt gacgtcggta cgcttcaagt gatcaccgaa
    6701  gccgaaaacc gaatcgagtt tttgcgagaa gttctcgccg aaatggcacg
    6751  gtatcgtgct tctctcgaga tacccgtacc gggttcgcct gacagtcctt
    6801  tgtttccacc gacgtacggt gagatcgagg agttaggtaa cgattcctct
    6851  gacagtgccc gattgatagg tgtggacaat ggttcagatt cagtgcccac
    6901  tgaaggcgac agggaactag actcggatgg tgatagcgat gattcaatac
    6951  ctttggatcg cgactttgag caaatcggag gtcttggcgg ggacggtaac
    7001  gttgacgtct ttcgtttagg gctgaggttc gtgtggagaa tgttgcgtaa
    7051  tttgtttaac ttaagagccg ttaaattttc ctatgggtta gctcttcagt
    7101  gtatatttaa cggcggttcc aatggccagt ttacgtcgcg actgttattc
    7151  agtttccggc aaactgttta cccgtttgag ttctttagac acgtttgcag
    7201  tgtgaggtgg ctgtcaaaga gcttagcact acatgttcgt aaccgcctaa
    7251  tttgtgacga ggaaacggtt gaacgtttct tcagtttttc gcgatttttg
    7301  tacgattcgc gttacttatc ggacgtgttt tcggtgttgg agagggtcga
    7351  tttttattta agttatctat tctcgttgcc gaagaggtgt cttacgcgta
    7401  accgtagtgt ccgagtttgc gctagagctc cagttcgtgt gattaggggc
    7451  gcgggacttg tagaagacgg caagaagtct ttaaccgaag tgttgaactc
    7501  tttggactca ttgaaagtgt ccgaccgtaa agggaagtca gcacttattg
    7551  aaagtgataa ttccgactcc gaaagcggtc attcattcgg gtctatctca
    7601  ttcggatcgg ttaatgagga agttttagaa gcagtgaacg gtggtgttgt
    7651  atccgaaaaa gctccactga tgaagcatgc ggctgcacta agcaggttgg
    7701  agccagatct tagtggtaat aaggatcttc ctattgtcag gagaagtttt
    7751  acccgcggtg aatcttcagg tacgaaaccg gcagaaagct tgtgcgtgta
    7801  cttaacgacg ttgaattctt cattcggttc ggtgcctgac ctgtatcccg
    7851  tcgcacgtga cataacgtac aagaagctga ccaacgccat gcgcgagttt
    7901  tattactcgc aaaaggtaac gttgtacgaa cttcatggta aattgagctc
    7951  gtactgggat gaattaaaga cggtaggttt tgataggaag ttggcgaaga
    8001  tggatttaga cgatgacgtt agtgtcgtcg attttaactt gaaggtaata
    8051  gtggggaggc atggtacccg tcctttcaga aatactgtga actctcacga
    8101  gttcatgttt tgtgatgacg gattggtgct ttgcccgggt ccgaaaaaac
    8151  gtgactttgc tctgatctct agtcaaacgc aatttgttgc tgcgaactca
    8201  ttcctgcgtg ccgtggacgg tagagatttg acgttcacta attcggagca
    8251  tagtctcata gtttatgagg ctcctcccgg tggtggaaag acgcattctt
    8301  tggtaaagta tttcgccgat tattgtacca aagtgtcttg cttggtggtg
    8351  accgctaaca aaaattcgca agcggagatt tctcaaagaa tctctaaaga
    8401  gttaatggat agaaagatgc ttgctaaaca cgttgttaaa accgccggta
    8451  gagtgttcac tgtggactct tatctgatga accatattcg acttaagact
    8501  gatttgttgt ttgtcgacga gtgttttatg gttcatgctg gagcaatcgg
    8551  agcggttgtt gagttcactt catgtaaggc tgtggttttc ttcggtgata
    8601  gtagacaaat tcattatatt caccggaacg attttggtgt ttcattgttg
    8651  catgacatag acgcatttat agaaccacag caccgcgttt acggtgaggt
    8701  gtcctacagg tgtccttggg acatctgtga gtggttgtct aaattctatc
    8751  cgagacatgt ggccactgct aacactggta gtatcgggaa atcgagtgtg
    8801  tctatagaga taattaatgg ctgtgacgat gttccttacg atagtagcgc
    8851  gaagtacatc gtttacacac aagcagaaaa gaacgaactg caaaagcacc
    8901  ttggtcgttt aaccgtaggc cgaactaaag cggtgcctat tgtgaacaca
    8951  gtgcatgaag ttcaaggtga aacatataag aaggttcgtt tggtaagatg
    9001  caaataccaa gaggacactc ctttctgttc agataatcat gttgttgtgg
    9051  ctttaaccag gcacgtcgac tccttaactt actccgtttt gaatagcagg
    9101  agatacgaca agaccgcttc cagtatagat gaagcgaggg agatttttga
    9151  caaatttcgt tcgacgaacc attctcacgg ttcttcgacg ttggaatggt
    9201  accttgagaa ataccctact gaatataagg gtagtaaagc atcttcggcg
    9251  ccgttaagtt gtattaacga gtttcttaac gaggtcgttg tcggttcttc
    9301  agttgtgcag ttgggagata tttcagaaga attaagttct cgtccttttg
    9351  agtctggatg tgacaatatt accgtaaggg acactgcacc ccctgattca
    9401  ggtaatctac acgaaccggc tcgcgttcgg cgtggtaagg tcgcaagcaa
    9451  ttccgccaag aaaagcgtcc ctacaagaaa atcttctgtc gtacgaaagt
    9501  cgtaattaca actttataaa gacggagcga tttgtggggc ccgaaaattt
    9551  tggtagagcc atggctgcgg ctgttattga gaggtgtttt aggatggacg
    9601  aagtggccaa gataagaagc gatattattg ctttgactga agccaatatt
    9651  caaaaatggc tcgataaacg tactccgtgt caggtaaaat ctgtgcaggc
    9701  cgaattgaag ttaccgtttg atgtggaaga gcaaatcacc aactacaaac
    9751  taatggttaa gcgtgatgct aaagtaaagc tcgatgattc gagtctgtcc
    9801  aagcaccctg ccgcacagaa tattatgttt cataagaagt ttattaatgc
    9851  tatttattct ccatgcttcg acgaatttaa gaatagggtg ttatcgtcac
    9901  taaacgggaa tatagtgttc tttaccgaaa tgacgaacgc tgggttggcg
    9951  gaagtcatta gaaggattat aggtgatgac gataatcttt ttgttgggga
   10001  agtagatttc agtaagttcg ataagtctca agatttgttt gtcaaggagt
   10051  acgagcgtgc gttatactct gagttcggat ttgatgacga acttctcgac
   10101  gtgtggatgg aaggcgagta ccgcgctagg gctaccacgt tagacggtca
   10151  gctgagtttt tcggtcgacg gtcaacgtcg ttcgggaggt tcgaacacat
   10201  ggattgggaa ctctttggtt accctgggta tcctatcctt gtattatgac
   10251  gtctcaaagt tcgagctact gcttatatct ggtgacgact ctctgatcta
   10301  ttcaaaagaa aagattagta acttttcttc agaaatttgt ctggagacag
   10351  gttttgaaac caaatttatg tctcctagtg tgccatactt ttgttcgaag
   10401  ttcgtggttc agacagggaa caaaacgtgt tttgtgccgg acccctacaa
   10451  gttattggtt aaactggggg ctcccaaata caaattgact gatgacgaac
   10501  tcttcgaact gttcacttcc tttaaagaca tcactcagga ctttggtgat
   10551  caggtggtcc tagagaaatt gaagttgtta gtagagacta agtacggctt
   10601  tactagcgga actactatgc ccgctctatg tgctatacat tgtgtacggt
   10651  ctaattattt gtcttttgaa aggttgtttc cctttattag aggttggtat
   10701  gttgtcgacg ctttgaagct tagacaactg aggaaattcg ccaatttgat
   10751  ctgtgaacgt gtggtttacg ataatcgcgt gggttatttt tcgtactttg
   10801  acaatccgtt tgctaaaccc gacgctagcg atggtcaagc ggatggctta
   10851  gcgacaggtt gatagtttgt tcagttccgc ctgagagcta acacgggtag
   10901  ttgagtcgag atgtttgcct tcgcgagcga aaaccaagac atattagaag
   10951  aaaagatttt tcgccgtaga acctgccacc gtaagtattt ggatgatgtg
   11001  gttagggact ttaccattga tattggttat gatactgtcg accgtgatcc
   11051  tacagtattg gccgattatt tctcgttgta tttctttttg cttaacaatg
   11101  ataacgttgg gcctttagca gcttcgatta tagtaagccc gccagtaaac
   11151  gggactcaca aaattcgagc gcacgtcgat aatcaaccga atcgtgaagg
   11201  aaacgttact tacgttaaga ctgttgataa gagtcgtttt gtgattcgca
   11251  taaaagcgat gccagcttct atgagaggct actactcctt tcgggcgttt
   11301  gttagtggtg acgtcgctag cgaacgtagt gagtttatat gcagctttgt
   11351  tggtagtagg tttctttgtt gttgtacaca aacgatatcc gaaaatttga
   11401  acaacgtttg ttcatcttcc ttcttcttta gagctgtctc ggaaaccgct
   11451  actaatgagt tttctgttgt gactgatgat gtagaagacg ttaagtacgt
   11501  aagaaagcga gtcgagggtt tttcacactg cgctgacccg tatccaccta
   11551  ggtgttatcg taacgctaat ttaggtgatt cttcaggggt ccaaagtcgc
   11601  acgattgaag aggaaggtta taggacggac actgtaggta acgtcgcggt
   11651  tactgtcccg aacactccac tcgttaatgc cgtctctccg tatgttgcgg
   11701  agtacaacga aaatacgcgt tcgcgtatct cgttaatacg gcgagtctgc
   11751  tgttacgccg tttgtgtttt agtggtttct cttcttataa tgagcggttt
   11801  gttgagcatc atattcatat gacttggtgt agtaacttat ggggcatggt
   11851  tagctaaaac tcaccgtttg actctgttta aacggggttc aatggactgt
   11901  gtaattcaag gatttttgac ttttctagtt ggtatagctg tgttttcggc
   11951  ttttgccgga ctaattatca ttgttataac gatttatcgg tgtacgacta
   12001  agcccgttag aaacgcctct ccttacggca ctcacgtcac tgtttaagcg
   12051  gtatggtgct tctgggttta gactttggta ccacgttttc gacggtggct
   12101  atggctacat cttctgagtt agtaatactt aaacaatcca attcgtcgta
   12151  catacctacg tgtttgtttc tgcatgcaga tcctaacagc gtgtcttatg
   12201  gttacgatgc ggagtactta gcggcttcgg gggaacctgg ctcgtttttc
   12251  aaagatttga aacggtgggt cggttgtact gagaagaact accaaagtta
   12301  tttgcacaag ttatcacctt cctataaggt gatagtaaaa gagttcggaa
   12351  ttaagagtat gccggttccg tatttgtcgc ctctgaataa tgatcttggg
   12401  ctcagtgtcg ctttgccttc gttaatcgct ttatatacca aatcgatttt
   12451  atcggatgcg gagagagtgt tcaacgtgag ttgcactgga gttatatgtt
   12501  cggtacctgc tggttataac acgttacaac gagcttttac acaacaaagt
   12551  gtgtccttgt cgggttatac ttgcgtgtac attattaatg aaccttccgc
   12601  tgccgcttac tccactttac ctaagttgag ttcggcggat aagtacttgg
   12651  ccgtttacga cttcggcggt gggacctttg acgtttctat agttagtgtt
   12701  aggttaccca cgttcgccgt tagaagttcg ggtggtgata tgaacttagg
   12751  cggtagagac atcgatagaa agttatctga taaaatatat gagttggctg
   12801  attttttacc gcaaaaagaa ctgaacgttt ccagtttaaa ggaagcttta
   12851  tctcttcaaa ctgatccagt caagtatact gtaactcatt acgggatgag
   12901  tgaaaccgta tcaatcgatc aaacaacgtt gagggagata gcttcggtat
   12951  ttataactcg aacgatagac atacttacac aagttaaagc taagtctagt
   13001  atgcccgagt cgcaaagttt gaagctagtg gtagtcggtg gaagctcgta
   13051  cctaccaggg ttgttggata ctttggaaac tgtacctttt gtgtctggga
   13101  tagtaccagt ggaagacgca agaaccgccg ttgctagggg atgcgcttta
   13151  tatagcgagt gtttggatgg taggtccaag gccttactaa tagattgcat
   13201  tacgcatcat ttgtcggtta cgacatttag tgcagactcg gttgttgttg
   13251  ctgcggccgg aagtccaatt ccttttgaag gagaacgaaa actcacgttg
   13301  cgtaagtgtg ttagtacatc gaattatcaa gcaaggatgt tcgaaggaga
   13351  ttacgaaaaa gttttccgaa acgaacgtat atacgcagct tcggtgtcat
   13401  tgtttacttt aggagttaac tggcgcgtgc ctaacgacgt tgagatgact
   13451  ctcgtgacca aagtggactc aatgggtaaa gtggaattct accttaaagg
   13501  tccatccggt gaattagtta acgtgcaagg tacttcacat tacgattatg
   13551  ttggtatgcc tcatcccact agaaagttgt tgaggcttag cgattacaat
   13601  gtaaactccg ccgctttagt tttagctttg acattgactc gcgaaaaacg
   13651  agaaaaattt cttttgcgaa ctttatttga cgctttacta gcggacttgc
   13701  gaaagaccga gattttaagc gaatattcta agaaatatcc gattactcga
   13751  aacgacattg atgtgccttc atcacgtatg gggatcgttg tttcgaaagt
   13801  tttacgggga agcgatttgg aaagagtacc tctctgaatc gactcgaaat
   13851  ttcgatgaga gaaacgtatc gttggaccac actttaagct caggtgtggt
   13901  cgtccgtagc caaaatcttt tgaacgcgcc tcaaggaact ttcgagaatg
   13951  agttagcgct attatacaat tcagtagtaa ttaacgattt tgttgaattg
   14001  actggtatgc cgttgaagtc tttgatgaca ggtgttgagg accgtaaaat
   14051  acctgacgag ttaatatccg ttgacccgca tgaagttgga tgtagattca
   14101  cgttgaatga tgtggaatca tatttaataa gcaggggtga ggattccgct
   14151  gatgtaacag cggttgagca ctcgtggtgt ttgagcaatt cttgtggtag
   14201  attgttaagt tcgactgaaa tagatactta caaaactatg gtgtttacta
   14251  agacttttga tagtggtgta tttggagtga ccactaaatt agagacgtat
   14301  ctatcatact gcatatcgtt gtacaagaaa cattgtatga aagacgatga
   14351  ttactttaac cttatattac ctatgtttaa ttgtttgatg aaagtgctgg
   14401  cgtcgcttgg tttgttttac gaaaaatata ctgacaatcc gctgctgacc
   14451  ggcatgctta tagagttttg tctagaaaat aaggtgtatt actctacttt
   14501  taaagtaaat ttggacaacg ttaggctgtt taagtctaaa gtgttgcctg
   14551  tggtgttaac ggtctgggat atatctgagc ctgatgatcc ggtggacgag
   14601  agaacactag ttcctttcga tcctacggat ttcgtgcttg atatacccaa
   14651  actgaatata cacgacacga tggtggtggt gggtaatcaa atcagacatt
   14701  tagagcacgt ggttgagagc gatgcattag acgacttgtc tcaacatgtt
   14751  gacttgaatt tagcagcgga caatcccgat ctacgcgttg atttgcgttg
   14801  ggcagggatg tttgtgtatt acggcatata ccggtgcgct gtagatagag
   14851  tggtagaacg accggcatta tttaatttgc cgcggaagtt gttaaatcag
   14901  gacgacggtg agtcatgctt gttacgtatg agttccgttg aaaccttatt
   14951  taatctggtg cagaaggtaa ataaggacat aaacattagg cgtcaattca
   15001  tgggacgtca tagtaaagtg gctttgcggt tgtatcgcaa tttaggtttg
   15051  aagtttcctc caatttcctc agttaggtta ccagctcatc acggctactt
   15101  gtacgtcgac ttttacaaaa gaatacctga taatgctgtt gacgccgacg
   15151  aactggaaag tttacgtcaa ttacgttcat ccgtggacgt tatgtgtaag
   15201  gacagagtgt caatcacgcc tccaccgttt aatcgacata gaagaggttc
   15251  ttctagaata cttagaggtc gaggggcagc cggtgcgagc tcgcgttata
   15301  tgagcagaga cgtggcaaca tccggtttta atttaccctt tcatcatggc
   15351  gggttacacg atgcttccta aaactgatga taaagaaatg gatccggtga
   15401  gtgccgctgt gcccggtaaa tacccggacg ttatcgaaaa gtttgtgacc
   15451  aataggcagg tagatgcgtt aatagaaggt gttattagca agttggatac
   15501  taattcaata tacgaagatt ccactgaaaa atttactggt gagcaattga
   15551  agtacgtcat ggttactatg gacactttct tactagaaaa ttacaaaacg
   15601  aaaacggaag atctgctggt tcacttggct atgattcaaa agaggttgtg
   15651  cactatatct acgagtacta aaaccaaatt tcgtgataaa ggttgtatca
   15701  gttacgtgca agggggttta cgatataagt taatggataa agtagttttt
   15751  ccttttatta tatctaagtt tactgacagg gagactccaa acgctctacg
   15801  taagtatgct tgtacttttg aggagttaca cttgtgcatg gctaggctga
   15851  gacccgactt atacgaaaac aaaaggacga ccaaagctgg gactccgcat
   15901  ttaaaaggct acttatcagc tgactttctt acgggttcac tcccaggata
   15951  ctccgaacat gaacgaggta tcattcttcg agcgtctgaa tctatgttag
   16001  ctagacgtca aggttacgag gaggcaaccg agcttcttaa cttacgcgat
   16051  ttgggaaagt atttgtagtt agtttgcgga cggtggtatt acgccatccc
   16101  atgagcactg ctttaagggt cgttaattga cgactcttga tatttactaa
   16151  gtttgagtta tggacgacga gacaaagaaa ttgaagaaca aaaacaagga
   16201  aacgaaagaa ggcgacgatg ttgttgcagc ggagtcttct ttcggttcct
   16251  taaacttaca catcgatccg actctaatag cgatgaacga tgtgcgtcag
   16301  ttaggtaccc aacagaacgc cgctttgaac agagatttgt tccttacttt
   16351  gaaagggaag tatcctaatt tgtctgataa agataaggac tttcacttag
   16401  ctatgatgtt gtatcgttta gcggttaaaa gttcatcatt gcaaagtgac
   16451  gacgacacca cgggcataac gtacactcgg gagggcgtcg aagtggattt
   16501  gtctgacaaa ctttggactg acgtcgtgtt taattctaag ggtatcggta
   16551  accgtactaa cgcccttcga gtctggggta gaagtaacga tgccctttat
   16601  ttagcgtttt gtagacagaa ccgcaatttg agttatggtg gacgtccgct
   16651  agatgcaggg attccggccg ggtatcatta cctgtgtgca gatttcttga
   16701  ccggagctgg cttgactgat ttagaatgtg ctgtgtacat acaagctaaa
   16751  gaacaattgt tgaagaagcg aggggctgat gaagttgtag ttaccaatgt
   16801  caggcagctt gggaaattta acacacgttg atctattacg ttctgattct
   16851  cgatttctat cgggatggtg gagtttcatc gtgaacgtgg gtgatataat
   16901  cgttcggttt gcgttacatg ttcctagtga agatatgctg aatagctttt
   16951  cagctatatc gaattgtacg atcatagcag acggtagtgc tttactaaag
   17001  gacaacactg tggttgaccg tttagagagc atgaatcctt tggcttattt
   17051  gttaaaatta gcgaaaacga ctactactat ttgttttact atgtctaata
   17101  aggttctttt tggtactact aaatccgaac cgcttagttg tttagctatc
   17151  acgtcggatc gagttttatt caaagttatt atgggtacta acgttgatga
   17201  ttctcgatgt ggttgcagta tttggtttta caacaatggg acgtttcaaa
   17251  acgggttgac ccgttgtaac aatctcgtcg ctttgtttag cgcgacttag
   17301  acacgaagtg accgttcggg tttaattgct gcaatgggta ttcgacgcgt
   17351  gtggttaaag attatggctg taattacggt attgtggtat ggtaaagaac
   17401  cttccattag cgaaggttac aatgctctta tgaatgacga ctttaagttc
   17451  attgatacgc acttttcaaa cgtttcttat gctaagaaat gttacgagtt
   17501  ggctaacttc gacttggact ttctacgcat cgtcatcatt cccttgagcg
   17551  gtggtgcggt gaatgaatcg cgtgctgatc gcgctaacgt ttcggagatt
   17601  gtcgaatcgc atgtgagcga ccgagacaga atgaaaatct tgttgcgtaa
   17651  taagcggatc cagattcctt cgctcttacc ttgcgataac tagagtctac
   17701  tcagtagtac gtctactagt ataacgtatt aaacacttta gtgaggagtt
   17751  ttgtttatac caaacaatat gcgagcttac tttagtgtta acgattacat
   17801  aagccttttg gctaaggtcg gtgcagttgt ggaacgtttg tgcgatccca
   17851  gcgtaactct cacggaagtg atggacgaaa ttaatgattt taactcgttt
   17901  ctcgctttgg tacactctat gaagtcggac atgaacggcg atcatcagga
   17951  tggtcaccat gagatgggtg aacacaagtc tcgattgttg tgcaatatag
   18001  aggcaaaact gcgaatactt ctcgacatca taagacgtcg gtttactcgc
   18051  gacaagctgc tctgtaccag cgcaacagat gtcatgggct tcttcgttat
   18101  gaggtacatg agttctagtc acaccagttt cgagtccgta atgcgaacgg
   18151  agctgaaatt agtggttaaa gcggtactgt cggatttatc ccgcgcgcat
   18201  aaactagatt ttagcgagcg agcctttgcg gcttacggta tccttttaca
   18251  aaagggtact gtagcgaccg tttgcggtca gtttgacatt aatttagttt
   18301  ctccttcatg cgtgtaggtt aatacgcttc tcagaacgtg tggttgtatt
   18351  aactaacttt aattcgaaca aatttattgt taaaagtctg tgagttacga
   18401  tggacgatac tagcggacaa acttttattt ctgtgaacct ttctgacgaa
   18451  agcaacacag ctagtactga aatcaaaacc gtaagttcag aagcggatcg
   18501  cttggaattt ttacggaaaa tgaatccctt cattatcgac gctttgatac
   18551  ggaaaaatag ttatcaaggc gctcgttttc gcgcgagaat aataggagtg
   18601  tgcgtggatt gtggtagaaa acacgataag gcatcgagga ctgaacgtaa
   18651  gtgtaaggtc aacaatacgc agtctcagaa cgaggtggcg catatgttaa
   18701  tgcacgatcc cgtaaaatat ttaaataaaa gaaaagctag agccttttct
   18751  aacgcagaga tgtttgcgat cgatttggtt atgcacacca aagagaggca
   18801  attagcggtt gatttggccg ctgaaaggga gaagacgaga ttggctcgta
   18851  gacacccgat gcgttctccg gaagagactc cggaacatta taaattcggt
   18901  atgactgcta aggcaatgtt accggacatc aacgctgtag acgttggtga
   18951  taacgaagac acctcgtcgg agtacccagt aagtctgagt gtttccggcg
   19001  gagttctccg tgaacaccac ttcatctgat tgaagtggac ggaataagtt
   19051  cctcgcggaa ctatatgtcg ggttggtaaa aacccttatg atggtgatat
   19101  atcactagac aataaccagg atgggtaaag tctttaaaat gatcgagggg
   19151  aaaattaact gtatcctctc gttggtctaa gctcccacag agtggtagtg
   19201  gtctcaagtg aggcttaacg tatgcgtgaa ccaaagaagt tctccttaga
   19251  gtgtgtgttg tttacccaac acactgtccc tatggggggc caacataggt
   19301  cc