Sequence of DPV Olive latent virus 1

Olive latent virus 1 gene for coat protein, complete cds.

ACC No: AB061815

Dated: 2003-07-07 | Length: 813 | CRC: 1552298818

                !!NA_SEQUENCE 1.0
ID   AB061815   standard; RNA; VRL; 813 BP.
XX
AC   AB061815;
XX
SV   AB061815.1
XX
DT   20-MAY-2001 (Rel. 67, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 4)
XX
DE   Olive latent virus 1 gene for coat protein, complete cds.
XX
KW   .
XX
OS   Olive latent virus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-813
RA   Kanematsu S.;
RT   ;
RL   Submitted (17-MAY-2001) to the EMBL/GenBank/DDBJ databases.
RL   Seiji Kanematsu, National Agricultural Research Center, Tohoku, Laboratory
RL   of Plant Disease Management; 4-Akahira,Shimo-Kuriyagawa, Morioka, Iwate
RL   020-0198, Japan (E-mail:s0813@affrc.go.jp, Tel:81-19-643-3465,
RL   Fax:81-19-641-7794)
XX
RN   [2]
RA   Kanematsu S., Taga Y., Morikawa T.;
RT   "Isolation of Olive latent virus 1 from tulip in Toyama Prefecture";
RL   J. Gen. Plant Pathol. 67:333-334(2001).
XX
DR   GOA; Q91UA2.
DR   SPTREMBL; Q91UA2; Q91UA2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .813
FT                   /db_xref="taxon:47669"
FT                   /mol_type="genomic RNA"
FT                   /organism="Olive latent virus 1"
FT   CDS             1. .813
FT                   /codon_start=1
FT                   /db_xref="GOA:Q91UA2"
FT                   /db_xref="SPTREMBL:Q91UA2"
FT                   /transl_table=1
FT                   /product="coat protein"
FT                   /protein_id="BAB55656.1"
FT                   /translation="MVNYFWDSRIQRWFYESGPQRVRTYMKADFTPPNGKLPARKTKRS
FT                   PPNRGNLQVLPVTAPAAGGAISTRRRVPRITTTNEQTVVRNTEIISAINSAALGAFSAT
FT                   TVTVIPSNLSWLAGLSDLYSKYRWRKLRFIYIPVCPTSTQGNVSMSLSFDRIDTQPTSI
FT                   TQMQQGYRAITFPPYAGYDGAMALSSFGNIPGMVVVDVDCARMDKLWYPNVTLATFLAM
FT                   ATNIQNGYCGVTLFTASDQGPAAATNFGQVFCQYEIEFIEPVNPTVNV"
XX
SQ   Sequence 813 BP; 212 A; 211 C; 188 G; 202 T; 0 other;

  AB061815  Length: 813  July 15, 2003 09:10  Type: N  Check: 1320  ..

       1  atggttaatt atttctggga tagtcgaatt cagaggtggt tctacgaaag
      51  tggaccacag cgtgtccgta catatatgaa agcggatttc accccaccaa
     101  acggcaaact gcctgctcgc aagactaaaa ggtcgccccc gaataggggc
     151  aacctacaag ttcttccggt tacagcacct gctgctggtg gagcgatctc
     201  cacaagaaga cgcgttcctc gaattactac tactaatgag cagactgtcg
     251  tgagaaacac agaaatcata agtgccatta attctgccgc gctaggtgca
     301  ttttcggcaa caactgtcac ggtaatcccg tccaatcttt catggttggc
     351  aggtttgtcc gatttgtaca gcaagtaccg ttggcgcaag ctccggttta
     401  tttatattcc ggtctgccca accagcacac aaggcaatgt ctctatgtca
     451  ctatcattcg acagaatcga tacgcagcca acaagcatca ctcaaatgca
     501  acagggctac cgtgccatca ctttcccgcc ttacgcgggg tatgatggtg
     551  ctatggcctt gtcatcattc ggcaacattc ctggaatggt tgtcgtggac
     601  gtggactgcg cacgaatgga caagttgtgg tatcctaatg ttaccctggc
     651  caccttcctg gccatggcaa ccaacatcca gaatggatac tgtggagtaa
     701  ccctgttcac tgctagtgat caagggccag ccgctgccac caactttggc
     751  caagtgttct gccagtatga aatcgaattt atagaaccag tgaacccaac
     801  tgttaatgtg taa