Sequence of DPV Helicobasidium mompa totivirus 1-17

Helicobasidium mompa No.17 dsRNA virus small segment, complete sequence.

ACC No: AB085815

Dated: 2006-10-05 | Length: 2096 | CRC: -786211487

                
ID   AB085815; SV 1; linear; genomic RNA; STD; VRL; 2096 BP.
XX
AC   AB085815;
XX
DT   14-AUG-2003 (Rel. 76, Created)
DT   05-OCT-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Helicobasidium mompa No.17 dsRNA virus small segment, complete sequence.
XX
KW   .
XX
OS   Helicobasidium mompa No.17 dsRNA virus
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RP   1-2096
RA   Osaki H.;
RT   ;
RL   Submitted (26-MAY-2002) to the EMBL/GenBank/DDBJ databases.
RL   Hideki Osaki, National Institute of Fruit Tree Science, Department of Plant
RL   Protection; 2-1 Fujimoto, Tsukuba, Ibaraki 305-8605, Japan
RL   (E-mail:hideki@affrc.go.jp, Tel:81-298-38-6546, Fax:81-298-38-6546)
XX
RN   [2]
RA   Nomura K., Osaki H., Iwanami T., Matsumoto N., Ohtsu Y.;
RT   "Cloning and Characterization of a Totivirus Double-stranded RNA from the
RT   Plant Pathogenic Fungus, Helicobasidium mompa Tanaka.";
RL   Virus Genes 26:219-226(2003).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2096
FT                   /organism="Helicobasidium mompa No.17 dsRNA virus"
FT                   /segment="small"
FT                   /mol_type="genomic RNA"
FT                   /note="small segment or satellite"
FT                   /db_xref="taxon:196690"
FT   CDS             315. .536
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q76L26"
FT                   /protein_id="BAC81755.1"
FT                   /translation="MSRNSRITLGLGPNAQKAAAPRFSRSIAVPVRAPSLVQAYNWLRN
FT                   DQVQKALALPEIEPPARLLSPPPQPNHT"
XX
SQ   Sequence 2096 BP; 519 A; 654 C; 506 G; 417 T; 0 other;

ab085815 Length: 2096  05-OCT-2006  Type: N  Check: 2478  ..

       1  aatcgaacgt aatttaagtt cgacagtgac ccgaggaccg gggcgcagag
      51  gataagccgc gactaagtaa ggtagcttgc gccacctcac tcagccgggc
     101  atcccaacac ccagtgttgt ccccggtgta gcctaccagc tctaatagct
     151  gttaggacgg tacgattcga gcggtgcgga atccgtaatt taagttgcac
     201  cgctcagaga aaagtaaccg gccaaatagg ccgcgtgtca ccgccgaagg
     251  gggccacagt ttcgctttca tggctgttgt cacaacgacg tgtggtgaga
     301  tagtcgtcac atagatgagt cggaattcca ggataacctt gggcctcgga
     351  ccaaacgcgc agaaggctgc agccccccgt ttttcgcgct cgattgcagt
     401  gccagtacga gcaccatcac tggtacaagc ttacaactgg ctgcggaacg
     451  accaggtaca aaaagcatta gctctgcctg aaatcgaacc acctgcaagg
     501  ttgttaagcc caccccctca acctaatcat acctaaaagg tgtgacatcc
     551  tcggaagaag gaatcaagcc caacaaggtc aaccgtccag gtacaaaaag
     601  ctttcgccct gcctgaagac gcccgaccac cccgcctctc ggaaaccccc
     651  cactcccaac tcactgtggt ctaccctcgg caccatgccg ccgtccaagc
     701  taggggtgga ctgcctcttg tgaaggacac ccattctagc ccagctcacg
     751  ctgtccgccc agacgaaacc ccccacttac ttactgacgc ccagggagtc
     801  gaaccctgat tcgaagacgc caggtcagcc gctctcccac cttcgatagt
     851  gggcgtgaac cgtcacacgc gactcagtgt ggatctacag accattaggt
     901  ccaggtacta tagccgtagc cagcctgaaa accccttggt cctccctcac
     951  ataaggactt ctccccgagg aatattatag agtagaagaa gggccgaagc
    1001  caaactacaa gcccgtccag gtacaaaagg agccagagca cctacgagtt
    1051  aacgcggtga tagccgtgcc ctgcctgaaa acggagaaag ctctatgaga
    1101  tatcggacgc cgccgaagcg aacgccttac ctcgtaccac ttaggtgtga
    1151  ccctaacata acgcaggtgt ctcgcgccct ttaagttggc tgaaaggtca
    1201  aggtagagca agacatgtcc cgcccttcac gtgagctgtc ctggtgagta
    1251  gacaacccac acctccgttc gacaggtggt gtactggggc cctgcgacct
    1301  taggtggcgt gtggcagcca gtccgcttat caagctgaca accgcttgcg
    1351  acaacgcaca atcccccttg caccggcttt tttacggctc gtgagtgcga
    1401  caccaggggc acctatccaa ccttaagccc tatggtttcc ctgcaggtgt
    1451  gatgggatcc gcttgggggc aaggcccgcg cggctgacaa agatgatgct
    1501  ccatctcggc cagattaggt atccactaac cccgtgtgcc tgacgtggat
    1551  ctaaaccgtg gtaaagaccc tccgcaaagt gtaccccgag agcatcggtt
    1601  ttacatcctg tcaccagaat gtgtacactc caacacacta gtgtattttt
    1651  aaagtttaag ccggccaggt actaaaggtc ccttacgaac ccagcctgaa
    1701  accgactctt ttttcgaagc cgccaggtac taaaacacat tttctgccag
    1751  cctgaaacga cgacgaaact taaacatatc cccggccagg tactatagaa
    1801  tccacaaggc gttagacaat gtccaggtac tgtaggcgct gctcccagcc
    1851  tgaaaacact gtcgatacca agctctcatc cagcctgaaa ccgaggaaca
    1901  ccctcgcgcc tgcaaagcca tcactgacta agctcacact aaggtgacca
    1951  actatcgggc tcactacacc cgtcgcgcct gcctttcgcc cgtacgatac
    2001  cggctcatcg gttacccccc taacgtccag cctgtaggac gcttcggtga
    2051  cttccccgca tgttgccgct cgtccctttg ctgactagcg agcacg