Sequence of DPV Helicobasidium mompa mitovirus 1

Helicobasidium mompa mitovirus 1-18 RDRP gene for RNA-dependent RNA polymerase, complete cds.

ACC No: AB110977

Dated: 2008-12-13 | Length: 2411 | CRC: 192025074

                
ID   AB110977; SV 1; linear; genomic RNA; STD; VRL; 2411 BP.
XX
AC   AB110977;
XX
DT   23-NOV-2004 (Rel. 81, Created)
DT   13-DEC-2008 (Rel. 98, Last updated, Version 2)
XX
DE   Helicobasidium mompa mitovirus 1-18 RDRP gene for RNA-dependent RNA
DE   polymerase, complete cds.
XX
KW   .
XX
OS   Helicobasidium mompa mitovirus 1-18
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus; unclassified Mitovirus.
XX
RN   [1]
RP   1-2411
RA   Osaki H.;
RT   ;
RL   Submitted (29-MAY-2003) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Hideki Osaki National Institute of Fruit Tree Science, Laboratory
RL   of Plant Pathology; 2-1 Fujimoto, Tsukuba, Ibaraki 305-8605, Japan
XX
RN   [2]
RX   DOI; 10.1016/j.virusres.2004.06.010.
RX   PUBMED; 15567032.
RA   Osaki H., Nakamura H., Nomura K., Matsumoto N., Yoshida K.;
RT   "Nucleotide sequence of a mitochondrial RNA virus from the plant pathogenic
RT   fungus, Helicobasidium mompa Tanaka";
RL   Virus Res. 107(1):39-46(2005).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2411
FT                   /organism="Helicobasidium mompa mitovirus 1-18"
FT                   /host="Helicobasidium mompa"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:233046"
FT   CDS             197. .2299
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="RDRP"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="BAD72871.1"
FT                   /translation="MIFKSQLRLWIDSAFRLSKQIERVESIRKWPKVICVYSAWAVLWT
FT                   HASYLPHVAKFLNMIVVLIKNNGLVYTIKYIKDIRLCVTRYMCGSPLSRSPSRFGLQKC
FT                   GWPRAIRYLKPSQGESFRNVLTLLNVLRFVEGVLPPSLNDIEDKWEGHIPAEILVFLEK
FT                   VFKPRYERFFTPLEFKKYHFSTHREPNGHAISSVLNDALSYDEKSSNALLGVSPEVHKR
FT                   MMNFLKLNEIVPLRHKLCRALFLDKIISKPAFARLVCIPAPEGKSRIIGEMNFWAQCAL
FT                   KPLHDKEMKALRSIRQDLTFYQGIGPQVLKLHPGSKYYSFDLKSATDRFPVELQEKVIQ
FT                   AFYGEDFARSWRSLITDQAFAYGESEVRYGCGQPIGAYSSWATFTLCHHMIVQMLCHRY
FT                   RAPRSHYIILGDDIVIAHDKVAEGYCEIMRALSVDISDLKTHVSKDSYEIAKRWFVNGE
FT                   EITPFPINSIIESGFKSAQVIQALMDASVKGWRLFDMITPAAALFISLQHASNFKNAFG
FT                   RIHHDLKVGGICTWVLKYLRGYIDGVSMLRNIQIIIDRPVLPCLSSAHYINDGVINNLV
FT                   VEIFSDSAASPGKGHQDVAFEAMPLITNPEEGVPIALEDAQDAIPHLGIYGQIEEQYLE
FT                   IIQIAFNFDQFHNGKWDLSLRALIVPDTSTVFSIRNHDIRTLVSSKIAARLVERIKVIA
FT                   ESPYGI"
XX
SQ   Sequence 2411 BP; 723 A; 502 C; 505 G; 681 T; 0 other;

ab110977 Length: 2411  13-DEC-2008  Type: N  Check: 9463  ..

       1  gggttgtccg cgaaagcgga cagtaccttg tcctgtttgg taacagaaca
      51  gacatgtaaa atagtcgaac cactattgcc ctaacacctt tgcagactcc
     101  cgatggaaac atcggcacag taagtgttca tatggtttag tatgtacaac
     151  ttaaagtacc gtagtgccaa cgataggccc ttcaataatt tataacatga
     201  tattcaagtc tcaactcaga ctatgaattg actctgcttt tagactttcg
     251  aagcaaatcg aaagagtaga gtcaattcgc aaatgaccaa aagtcatttg
     301  tgtatatagt gcttgagctg tactgtgaac tcatgccagt taccttcctc
     351  atgtcgctaa atttctgaat atgatcgtag tacttattaa gaacaatggt
     401  cttgtataca caattaagta tattaaagat atacgtcttt gtgttacaag
     451  atacatgtgt ggttcaccac tctctcgctc accgagtaga ttcggtctgc
     501  aaaagtgtgg atggcctaga gcaatccgtt atctaaagcc tagccaaggc
     551  gaaagcttta gaaatgtgct tactctactt aatgtactaa gattcgttga
     601  aggcgtgctt ccaccatcac tcaatgatat tgaggataag tgagaaggtc
     651  atatccctgc tgaaatcctt gtctttctag aaaaggtatt taagccgagg
     701  tatgaacgat tcttcacccc actagagttt aagaaatatc atttctcaac
     751  tcatagagag ccgaatggtc acgcaatcag ttcagttctt aatgatgctc
     801  tgtcttacga cgagaagagt tctaatgctc tactcggtgt aagtccagag
     851  gttcataaaa gaatgatgaa ctttctgaaa cttaacgaga tcgtacccct
     901  aagacacaaa ctctgtcgag cgctattcct tgataaaatt atatcaaagc
     951  cagcgttcgc tagacttgtg tgcatcccag ctcctgaagg gaaatcaaga
    1001  attatcggtg aaatgaactt ttgagcacaa tgtgcactaa agccacttca
    1051  tgataaagaa atgaaagccc ttcggagcat cagacaagat cttacattct
    1101  atcaaggaat cggtccgcag gtgcttaagc ttcatcccgg tagtaaatac
    1151  tacagttttg atcttaagtc cgctacggat agattcccgg tggaactcca
    1201  agaaaaggtg attcaagcct tttatggaga agattttgcc agatcctgaa
    1251  gatcactcat aactgatcaa gcttttgcct atggcgaaag cgaagtcaga
    1301  tatggatgtg gtcaaccgat aggtgcatac tcgtcatggg cgacatttac
    1351  actctgtcat catatgattg tacagatgct atgtcaccga tatcgagcac
    1401  ctagaagtca ctacattatc ctgggtgatg acattgtcat cgcacatgat
    1451  aaagtagcgg aaggatactg tgaaattatg agagcactat ctgttgatat
    1501  ctcggatcta aagacccacg tatcaaaaga tagttatgaa atcgctaaac
    1551  gatgatttgt taatggagaa gagataactc ccttcccaat taattcaatc
    1601  atagaaagcg gtttcaagtc tgctcaggta attcaggctc taatggacgc
    1651  atccgtgaaa ggatgacgac tatttgacat gattaccccg gcagcagcac
    1701  tctttatctc actgcagcat gcgtcaaact ttaagaacgc ttttggaaga
    1751  atccatcacg accttaaggt aggaggcatc tgtacgtgag tgctcaaata
    1801  tctcaggggt tacattgatg gtgtctcgat gcttagaaac atccagatca
    1851  tcatagatcg ccctgtacta ccttgtctat catctgctca ttatattaat
    1901  gacggtgtga taaacaacct ggtagtggag atatttagcg atagtgctgc
    1951  ctctcctgga aaaggacatc aagacgtagc ttttgaagct atgcccctga
    2001  ttaccaatcc ggaggagggc gtgccaatag ctctcgagga tgctcaagac
    2051  gcaattccac atcttggaat ctatggtcaa attgaagagc aatatctgga
    2101  aatcatacag atagctttca attttgatca gttccataat gggaaatgag
    2151  atctttcgct tagggctctt attgttccag atacttcgac agtattctca
    2201  ataagaaacc atgatattcg tacactagta tccagcaaaa ttgctgcgag
    2251  actagtggaa cggatcaagg taattgctga gtcaccgtat ggcatctagt
    2301  acaacttcaa gccccaggtg ttccttttgg gtacacctga cttactgaat
    2351  gaaagtgatt ttagtatcac ggggtgttca gtaaggttct gtccgctttc
    2401  gcggacaacc c