Sequence of DPV Magnaporthe oryzae virus 1

Magnaporthe oryzae virus 1 genomic RNA, complete genome.

ACC No: AB176964

Dated: 2008-06-21 | Length: 5359 | CRC: 1415599680

                
ID   AB176964; SV 1; linear; genomic RNA; STD; VRL; 5359 BP.
XX
AC   AB176964;
XX
DT   13-OCT-2004 (Rel. 81, Created)
DT   21-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Magnaporthe oryzae virus 1 genomic RNA, complete genome.
XX
KW   .
XX
OS   Magnaporthe oryzae virus 1
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-5359
RA   Yokoi T., Yamashita S., Hibi T.;
RT   ;
RL   Submitted (13-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Toshiro Yokoi Forestry and Forest Products Research Institute; 1
RL   Matsunosato, Tsukuba, Ibaraki 305-8687, Japan
XX
RN   [2]
RA   Yokoi T., Yamashita S., Hibi T.;
RT   "The nucleotide sequence and genome organization of Magnaporthe oryzae
RT   virus 1";
RL   Arch. Virol. 152:2265-2269(2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5359
FT                   /organism="Magnaporthe oryzae virus 1"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:271257"
FT   CDS             575. .2815
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="putative coat protein"
FT                   /db_xref="GOA:Q60GI3"
FT                   /db_xref="InterPro:IPR008871"
FT                   /db_xref="UniProtKB/TrEMBL:Q60GI3"
FT                   /protein_id="BAD60832.1"
FT                   /translation="MAQIGAPNFLSSVLGDQRGGVLNSDSVFRRYRAAITTSTIVRGVQ
FT                   DTRVGFLVFAVGRVFSSFSAALVRPKSSVPAIDATYPCPATRSEEFVGLAKKYSNFSST
FT                   FTHANFAGVVERLSRALAVLSTLPDSDTAALTSLDIAGGVMPTVYSIATFDSPVNALAR
FT                   VVFIPRIVDSLLSPNSLAVLIAAVAGEGSSVATDILRLDVSTRKAIVPIVSGPGLATAI
FT                   VDALRVLASNMVEAGQGQLFSFAVTRGLHQALNVSSGTDGQYVMQSILRSGRFSPPLGG
FT                   IHTSLPVFSGLPALVSESRRDVATFVDALALVSAAGAAPADPCIVERGNTFPTVLVSPG
FT                   QISDLDSSSSMPGAFPSTPQLLGQLKEALPAFFSNYLRILSTVFAAGESDSVALDCACA
FT                   FASLLEDLPTPLSAPTVLPFFWVEPTSLLPASVFSTTAESAGFGALATPGSPVTRPAWG
FT                   AIEHLVSPSSAVSTATVSWTSARQNPFLWHFKGMRSDPLAAVIVDQFDPTDLAFAGPGG
FT                   AETTLQKWGRQAPLTDYLWRDSASCLPAPGELLNLSGAIGLRFRHFVIDDNDDCAFTRI
FT                   PMFHEIGTGSVTIAVSRPCGLAPDGPPARLERATVVSPALGYLRQRGANLRAFGRPDDL
FT                   LAPRRLGPASLTVAPKAPPAPVSAPVSSFAFSGPKTSSRDPLSGELPTPLVPVQHYKAE
FT                   TGPKTGGLGAAGGGGGTVKPPTAVPPGLTEVPTAPDAGPTPEPHGAAPSLHE"
FT   CDS             2818. .5316
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="putative RNA dependent RNA polymerase"
FT                   /db_xref="GOA:Q60GI2"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniProtKB/TrEMBL:Q60GI2"
FT                   /protein_id="BAD60833.1"
FT                   /translation="MDLEARSKSFGRLGMSCSSIYSKYRDHLPVFSSMDFLSGLTYVTT
FT                   NVGVLRSHHPLLPTAVSLLCLDFPIQFDTSSSHCLLLAQSAYMTVDELARSYPCKFGGR
FT                   RILGRLIHDSTFREATFPVKSHPAAHTKAHISLGALLRSWPSVAPRSEIDYILARCAGR
FT                   LTADQAIALIVYHVSLRPTFGLSSARFAVAALMCPGDAKGLSNALKALGLNGVKEGAVL
FT                   VEAQTLQGRGVAPIDWGREIPSRCTDAVHENTVFIPEADLRAHVRHFLSSELDADTSLE
FT                   PLDHWWSRRWAWCVNGAHTSAASRALGIDHRHAFPAHSRVYRRMASEALESEPVSKWDG
FT                   TTFVSASEKLEHGKTRAIFACDTRSYFAWSWLLDPVAANWRNSRILLDPGRGGTYGSTR
FT                   RIQNAQLTGGVNVMLDYDDFNSQHSTRSMQIVTEELCSYIGAPQWYTDVLVKSLDSEYI
FT                   TGHGPPRHVAGTLMSGHRGTTFFNSILNGVYIRHAFGAGAFDSCVSMHTGDDVYMRLRT
FT                   LRDASTLLVSLKDLGCRLNPTKQSIGYKHAEFLRVAITPTGSRGYAARSIAALASGNWT
FT                   DSDPMDARDGFTTTLANIRTIQLRSGSPDLGRLVGPAVKYARGLRTRTVIKILNGEESY
FT                   NGSPVYNVPGRTVKVHTFAPKDPDYMLPEIPVSSSWPLNSTYDYLNSHCTGLESRLFEI
FT                   AQVSPVPLLAASSYSKGLAQSRQVLTSADLTIRPLGTVSTLGVIDVGSLSAAPPSPPVL
FT                   AGHPLARLVAARVSDDDLREILDQFAIPPPPADMTVREYAFGYEPHCVNVRGFLPHADA
FT                   SSLSARTRAGTIFVPTPVNV"
XX
SQ   Sequence 5359 BP; 907 A; 1708 C; 1396 G; 1348 T; 0 other;

ab176964 Length: 5359  21-JUN-2008  Type: N  Check: 7069  ..

       1  gacacggcag tacctgttct ggttctggga gtttgcccgc ctccatccgt
      51  gtcttaggga accaaatcct cgtggttggc cgccgttgtt ggtaaggccc
     101  ctatggtgag gtaactggcc tcgtgccggg tgtggtatct gttcgccact
     151  cgacagatac tgctaacgta acggtgtagt ggtgatgtta tgaagatcga
     201  cgtcctagtg agcgagtctt gtacgagtac cctttttggg acggtccagg
     251  atagtgaagg acgtaaatgt atagtaacta tatacaccgg gaacgtgcct
     301  gccgcatgct tagcgctgcc gcaggtggac tgactgacac tcaccatgtg
     351  ttcaaattcg gactggctct gatcagtagc gattgcaccg agcaaacagt
     401  cggaggggca cccccccttg atttggattc agaacaccca tctgaattgg
     451  aaacgcgacc tcctccaatt ctcgatctac gcggccttga tcaccgtact
     501  tctgcttctg ttgtgtgata ttctgtggta agctcacagc gcgggaacct
     551  cttcggagta gtacgcacac caacatggca cagattggtg cccccaactt
     601  cctgtcctcg gtcctcggtg accagcgggg cggagtccta aactcggact
     651  ccgttttccg tcggtaccga gccgccatca ctacctccac gatcgtgcgt
     701  ggagtccaag atacccgagt gggtttcttg gtcttcgccg tcggtcgtgt
     751  gttttcgtct ttctctgctg ccctggtccg ccccaagtcg tctgtccccg
     801  cgatcgacgc gacttaccct tgtcccgcca cacggtcgga agagtttgtc
     851  ggtctggcaa agaagtattc caacttctcg tcgaccttca ctcacgccaa
     901  ctttgctggt gtcgttgagc gtctgtctcg tgccctcgct gtcctgtcta
     951  ccctccccga ttccgacact gctgccctca cgtcccttga cattgcaggt
    1001  ggcgtcatgc caacggtcta ttcgatcgcc acgtttgact cccccgtcaa
    1051  tgctcttgca cgtgttgtct tcattccccg gattgtagac tcgctactct
    1101  cgccgaactc tctcgccgtc ctcatcgctg cggttgcggg ggagggaagc
    1151  tctgttgcca cggatattct gcgcttggac gtctccacta ggaaggccat
    1201  agttcctatc gtgtcgggtc ccggtctcgc gaccgcgata gtcgacgctc
    1251  ttagggttct ggcctccaac atggttgaag ctggccaagg tcaattgttt
    1301  tcgtttgccg tcacgcgtgg tctccaccaa gccctgaacg tctcaagtgg
    1351  gactgacggg caatacgtga tgcagtcgat tctccgttct ggtcgtttct
    1401  ctcctccgct cgggggtata cacacgtcgc tacctgtctt ctctggtctc
    1451  ccggccctcg tgtcggagtc acggagggac gtagcgacgt ttgtcgatgc
    1501  ccttgccctt gtctctgccg ctggtgccgc ccccgccgat ccctgtatcg
    1551  ttgagcgggg gaatacgttc ccaacagtcc tcgtctctcc aggccagatc
    1601  tctgacctag actcgtcctc gtccatgcct ggtgcgttcc cctcaactcc
    1651  acagttgttg ggacagctga aggaggccct ccctgccttc ttctcaaact
    1701  acctgcgcat cctgtcgacc gtctttgccg ctggcgagag cgactccgtt
    1751  gccttggatt gtgcctgtgc cttcgcgagt cttctcgagg atctgcccac
    1801  ccccctgtct gcgcccaccg tactaccgtt cttctgggtc gagcccacct
    1851  ctctcctccc cgccagtgtg ttttcaacca ctgccgagag tgcaggattt
    1901  ggggcgctcg caacccctgg cagtcctgtc actcggcctg cctggggtgc
    1951  catcgaacac cttgtctctc cctcgtccgc tgtttcgaca gccaccgttt
    2001  cctggacttc cgcccgccag aaccctttcc tttggcattt caaagggatg
    2051  cgttccgacc cgcttgccgc cgtcatcgtc gaccagttcg acccgaccga
    2101  cctcgccttc gccggacccg gtggtgccga gacgactcta cagaagtggg
    2151  gtcgtcaagc accgctcacg gattacctgt ggcgcgactc tgcctcctgt
    2201  ctgcctgccc ccggagagct actcaatttg agtggtgcca tcggtcttcg
    2251  tttccggcac ttcgtcattg atgacaatga cgattgtgcg ttcacgagga
    2301  tcccgatgtt ccacgagatt ggaactggct ccgtcacgat tgctgtctcc
    2351  cgtccttgtg gtctcgcccc cgatggtcct cccgcccgtc ttgagcgtgc
    2401  aacggttgtc tcccccgccc tgggttatct caggcagcga ggtgcaaact
    2451  tgcgcgcttt cggtcggccc gatgatcttc tggccccgcg tcgactcggt
    2501  ccggcctcgc tcacggttgc cccgaaggct ccccctgctc cggtttctgc
    2551  tcctgtctcg tcctttgcgt tctctggccc caagaccagt tcccgcgacc
    2601  cactttctgg tgagttgccc acgcctcttg tgccagtcca gcactataaa
    2651  gctgagactg gtccaaagac tggtggtctt ggcgcggctg ggggtggtgg
    2701  tggcaccgta aaaccaccga ccgccgtacc tcccggctta acggaggttc
    2751  cgacggcccc ggatgcaggg ccgacccccg aaccccacgg cgcggcgcct
    2801  agcctgcacg aatagatatg gatcttgaag ctcgttccaa gtccttcggg
    2851  cggctcggaa tgagctgttc gtctatctat tcgaagtacc gtgaccatct
    2901  ccctgttttt agctcaatgg attttctctc cggtctcacc tacgttacca
    2951  cgaacgtagg tgtcctacgc tctcaccacc cgttgttgcc cacggccgtg
    3001  tcgctcttgt gtttggactt cccgatccag tttgatacgt cctccagcca
    3051  ctgcctacta cttgcacagt cagcctatat gactgtagat gagttggcac
    3101  gctcttaccc ttgtaagttt ggaggacgtc gcattctggg taggctcatt
    3151  catgactcga ccttccgtga ggccaccttc cccgtcaagt cccaccccgc
    3201  tgcccacacc aaggctcaca tcagtctggg tgcgctcctg aggtcttggc
    3251  cgtctgtcgc cccccgctct gagattgatt acattctggc gcgctgtgcc
    3301  ggtcgcttaa ctgccgacca ggcaatcgct ctgattgtat accacgtctc
    3351  tctgcggccg actttcggct tatcctctgc gcgcttcgct gttgccgctc
    3401  taatgtgccc cggcgacgcg aagggactct cgaacgcgct gaaggctctc
    3451  ggtctcaacg gggtgaaaga aggtgcagtc ctagtcgagg cacaaaccct
    3501  acaaggtagg ggggttgctc caatcgactg gggtcgtgag atcccctctc
    3551  ggtgtacaga tgcagtgcac gaaaacactg ttttcatacc cgaggccgat
    3601  ctccgagctc atgtcaggca tttcctctca tccgagttgg atgctgacac
    3651  gagtctggaa cccctcgatc actggtggag tcgtagatgg gcgtggtgtg
    3701  taaacggtgc acacacgtca gctgcgtcac gagctcttgg tattgatcat
    3751  cggcacgcct tccctgccca ctctcgcgtc taccgacgca tggcctcaga
    3801  agccctagag tctgaacccg tctccaagtg ggatggtacg accttcgttt
    3851  ctgcgtctga gaagctggag catgggaaga cgcgtgcgat ctttgcttgt
    3901  gacacacggt cttatttcgc ttggtcctgg ctccttgacc ccgttgccgc
    3951  aaattggcgc aactctcgga tccttctcga ccctggacgc ggcggcacgt
    4001  acggtagtac tcgccgcatt cagaatgcac aactaaccgg tggcgtcaat
    4051  gtcatgcttg actacgacga cttcaactct caacactcga cccgctctat
    4101  gcagatcgta accgaagagt tgtgttcgta cattggcgca ccgcaatggt
    4151  acacagatgt cctcgtgaag tctctcgact ccgagtacat cactggtcac
    4201  ggcccccctc gacatgttgc cggtacgctc atgtccgggc accgaggcac
    4251  gacgttcttc aactccatcc tcaatggagt ttacattcgt cacgctttcg
    4301  gcgccggagc cttcgactcg tgtgtatcaa tgcacaccgg cgatgacgtg
    4351  tatatgcgac ttcgtaccct ccgtgatgcc tccacccttc tggtttcgct
    4401  caaggatctc ggttgccggt taaatccaac caaacagtca atcggataca
    4451  agcatgctga attcctccgt gtcgcgatca ctcctacggg ttcccgtggg
    4501  tatgccgctc ggtcgatagc agcccttgca tccgggaatt ggacggactc
    4551  ggaccctatg gacgctaggg atggttttac gaccaccctc gcaaatatac
    4601  ggacaatcca gttgcggtcc ggttccccag acctaggtcg tttggttggt
    4651  ccggcagtta agtacgcccg cggtttacgt acacggactg ttattaagat
    4701  tctcaatggt gaggagtctt ataacggttc tcccgtgtac aacgtgcctg
    4751  gtaggacggt caaagtccat accttcgcac cgaaggaccc ggactacatg
    4801  ctgccggaga ttccagtttc atcctcttgg cctctgaact ccacatacga
    4851  ctaccttaac tcccactgta cgggtctcga gagtcgtttg tttgagatcg
    4901  ctcaggtgtc ccctgttccg ctgctcgctg cctctagcta ttccaagggc
    4951  ctagcgcagt cacgacaggt gctcacttct gcggacttga ccattcgtcc
    5001  cctcggtact gtcagtactt tgggcgtgat agatgtcggg agtctcagcg
    5051  ctgcaccacc ctcacctccg gtgttggctg gccaccccct cgcccgactt
    5101  gttgctgctc gtgtcagtga cgacgacctg cgagagatac tggatcaatt
    5151  cgccataccc ccgccacctg ccgatatgac ggtgcgcgag tacgcatttg
    5201  gttatgagcc ccactgtgtt aatgtgcgcg gcttcttgcc ccacgccgat
    5251  gcgtcttccc tctcagccag aacacgagct ggcacaatat tcgtacctac
    5301  ccccgtgaat gtgtaggtca ggtctgtggg gaccttttct tcgtgcccct
    5351  aacggggca