Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus CP gene for coat protein, complete cds, isolate: Shiz-1.

ACC No: AB244054

Dated: 2006-11-22 | Length: 1167 | CRC: -1628643764

                ID   AB244054; SV 1; linear; genomic RNA; STD; VRL; 1167 BP.
XX
AC   AB244054;
XX
DT   22-NOV-2006 (Rel. 89, Created)
DT   22-NOV-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Tomato bushy stunt virus CP gene for coat protein, complete cds, isolate:
DE   Shiz-1.
XX
KW   .
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1167
RA   Natsuaki T.;
RT   ;
RL   Submitted (08-DEC-2005) to the EMBL/GenBank/DDBJ databases.
RL   Tomohide Natsuaki, Utsunomiya University, Faculty of Agriculture;
RL   Mine-machi 350, Utsunomiya, Tochigi 321-8505, Japan
RL   (E-mail:natsuaki@cc.utsunomiya-u.ac.jp, Tel:81-28-649-5449,
RL   Fax:81-28-649-5401)
XX
RN   [2]
RA   Fujinaga M., Morikawa T., Doi M., Yoneyama C., Ibrahim M., Ogiso H.,
RA   Miyamoto K., Miyasaka M., Ohki T., Kameya-Iwaki M., Natsuaki T.;
RT   "Two tombusviruses isolated from lisianthus [Eustoma grandiflorum (Raf.)
RT   Shin] with necrotic stint.";
RL   Nippon Shokubutsu Byori Gakkaiho 72:109-115(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1167
FT                   /organism="Tomato bushy stunt virus"
FT                   /isolate="Shiz-1"
FT                   /mol_type="genomic RNA"
FT                   /country="Japan:Shizuoka"
FT                   /isolation_source="lisianthus"
FT                   /db_xref="taxon:12145"
FT   CDS             1. .1167
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="ORF3"
FT                   /protein_id="BAF37070.1"
FT                   /translation="MAMTTRNNNNVLAVSKKQLGALAASAAAGALRNYISESGPALLQS
FT                   AVGLGKKALNKVRNRRKQGNQQIITHVGGVGGSIMAPVAVSRQLVGSKPKFTGKTSGSV
FT                   TVTHREYLTQVNNSSGFVVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYSFNNVVLH
FT                   YVPLCGTTEVGRVALYFDKDSQDLEPADRVELANFGVLKETAPEAEAMVRIPTDKVKRY
FT                   CNDSSTVDQKLIDLGQLGIATYGGAGTNAVGDVFISYSVTLYFPQPTNTLLSTRRLNLT
FT                   GTLAGAAGPGYLVLTRTPTVLTHTFRATGTFNLSGGLRCLTSLTLGATGAVVINDILAI
FT                   DNVGTASAYFLNCTVSSLPATVTFTTTGISSATVNVVRSTRANVVNLL"
XX
SQ   Sequence 1167 BP; 301 A; 268 C; 300 G; 298 T; 0 other;

ab244054 Length: 1167  22-NOV-2006  Type: N  Check: 6861  ..

       1  atggcgatga caacgagaaa taacaacaat gtgctcgctg tgagcaagaa
      51  acagttgggg gccctagcag catctgccgc tgcgggggct ctgcgtaatt
     101  atattagcga gagtggcccg gcactgctac aatcagcagt gggtttggga
     151  aagaaggcct taaataaggt gaggaatcga aggaaacagg gaaatcagca
     201  gatcattact catgttggtg gcgttggggg ctcaatcatg gctcctgtgg
     251  cggtgtccag gcaactagta ggtagtaagc cgaaatttac cggaaagaca
     301  tctggatctg tcacagtaac gcaccgtgag taccttaccc aagtaaataa
     351  ttcttcagga tttgtggtaa atgggggtat tgtcggcaat ttgttacaac
     401  tcaacccgtt gaatggaaca ctgttctcgt ggctgcctgc catagcatcc
     451  aattttgatc agtactcatt taacaacgtt gtgttacatt acgtccccct
     501  gtgtggcact actgaagtag ggcgtgtagc gctatacttt gataaggact
     551  cacaagatct tgagcctgct gatagagtgg agttggcgaa cttcggtgtt
     601  ctaaaggaga cagccccaga ggctgaggca atggtgcgca tacccactga
     651  caaagttaag agatactgta atgacagttc cacagttgat cagaaactta
     701  tagatttggg acagcttggt atcgctactt atggaggagc aggtacaaat
     751  gctgtggggg atgtgttcat ttcctacagt gtcacactgt actttcctca
     801  acccaccaac accctgttga gtacacgacg gcttaacctt accggaactt
     851  tggccggtgc tgctggacct gggtatcttg tcctgacaag aactcccaca
     901  gtcttgacgc acacatttag ggcgactggc acctttaacc tctctggagg
     951  tttgaggtgc ttgaccagtc tcactctcgg agcaacgggg gcagtggtta
    1001  tcaatgacat acttgctatt gacaatgtgg gcacggctag tgcctacttc
    1051  ctcaattgca cggtatcctc tctacctgcc accgtaacat ttacaacaac
    1101  tggaatatct tccgccaccg tcaacgtggt gcgtagtaca cgagccaatg
    1151  ttgttaactt actgtaa