Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus CP gene for coat protein, complete cds, isolate: Nag-4.

ACC No: AB244055

Dated: 2006-11-22 | Length: 1167 | CRC: -2018024270

                
ID   AB244055; SV 1; linear; genomic RNA; STD; VRL; 1167 BP.
XX
AC   AB244055;
XX
DT   22-NOV-2006 (Rel. 89, Created)
DT   22-NOV-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Tomato bushy stunt virus CP gene for coat protein, complete cds, isolate:
DE   Nag-4.
XX
KW   .
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1167
RA   Natsuaki T.;
RT   ;
RL   Submitted (08-DEC-2005) to the EMBL/GenBank/DDBJ databases.
RL   Tomohide Natsuaki, Utsunomiya University, Faculty of Agriculture;
RL   Mine-machi 350, Utsunomiya, Tochigi 321-8505, Japan
RL   (E-mail:natsuaki@cc.utsunomiya-u.ac.jp, Tel:81-28-649-5449,
RL   Fax:81-28-649-5401)
XX
RN   [2]
RA   Fujinaga M., Morikawa T., Doi M., Yoneyama C., Ibrahim M., Ogiso H.,
RA   Miyamoto K., Miyasaka M., Ohki T., Kameya-Iwaki M., Natsuaki T.;
RT   "Two tombusviruses isolated from lisianthus [Eustoma grandiflorum (Raf.)
RT   Shin] with necrotic stint.";
RL   Nippon Shokubutsu Byori Gakkaiho 72:109-115(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1167
FT                   /organism="Tomato bushy stunt virus"
FT                   /isolate="Nag-4"
FT                   /mol_type="genomic RNA"
FT                   /country="Japan:Nagano"
FT                   /isolation_source="lisianthus"
FT                   /db_xref="taxon:12145"
FT   CDS             1. .1167
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="ORF3"
FT                   /protein_id="BAF37071.1"
FT                   /translation="MEMVTRNRNNVLAVSKKQLASMAATAAMGAIGNYVKQNGVTMIKD
FT                   AVTLGTKAIRSARNRRKKGNQQEIVHVGGTGGAMMAPVAVSRQLIGSKPKFAGRTSGSV
FT                   TVTHREYLTQVNNSSNFTVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYVFNSVVLH
FT                   YVPLCGTSEVGRVAMYFDKDSKDPEPADRVELANFSVLKETAPWAEALLRVPVDKVKRY
FT                   CDDSTVVDRKLIDLGQLGLATYGGAGANPVGDVFVSYSVTLYFPQPTSSLLSTRQLNLA
FT                   GGLAGSAGPGYIIVSTTPTVLTITFRSTGTFLVAGTFRDTVVSVLGSTGSIGINSQTTL
FT                   DTVGLATSFFINCTVSALPATITYTSTGITSATVQCTRAVRANTTSLL"
XX
SQ   Sequence 1167 BP; 296 A; 274 C; 303 G; 294 T; 0 other;

ab244055 Length: 1167  22-NOV-2006  Type: N  Check: 6333  ..

       1  atggagatgg ttacacgcaa tcgtaataat gtgttggcag ttagcaagaa
      51  acagttagca tctatggctg caacagcagc tatgggtgcg ataggaaatt
     101  atgtgaaaca gaatggagtg acgatgatta aagatgcggt gacgctgggt
     151  actaaagcga tccgctctgc caggaatcgt aggaagaaag gaaatcagca
     201  ggagatagta cacgtaggtg gtacaggtgg ggccatgatg gccccggtgg
     251  cagtgtctag acaactcatc ggcagcaagc ctaagtttgc cggtcgtact
     301  tctggatctg tcacagtcac ccaccgtgag tacctgacac aagtcaacaa
     351  ctcgtcaaat tttacagtca atgggggtat tgtcggcaat ttgttgcagc
     401  ttaacccgct taatgggaca ctcttttcat ggttaccggc catagcgtca
     451  aactttgatc agtatgtctt caacagcgtg gtgctacact atgtccccct
     501  atgcggcacc agtgaggttg gtcgggttgc tatgtacttt gataaggact
     551  cgaaggatcc tgaacctgct gatagagtgg agttagctaa cttcagtgtg
     601  cttaaagaga ccgccccatg ggcggaagca ttgctcaggg tacccgtcga
     651  taaggttaag agatactgcg atgacagtac cgtagttgat cgcaagctta
     701  tcgatctggg gcaattgggc cttgcgacat atggtggcgc tggagctaac
     751  cctgttgggg atgtgtttgt gtcctacagc gtgacacttt actttccaca
     801  accaacaagt tccctattat ctacaaggca gctaaacttg gcaggcggtc
     851  tggctgggag tgctgggcct ggctacatta ttgtcagcac aacaccaacg
     901  gtcttaacaa ttacgtttcg ctccacaggc actttccttg tcgccggaac
     951  cttccgagac acagtagtgt ccgtcctggg tagcacaggg agtattggga
    1001  ttaactcaca aaccacactc gacacagtgg gacttgccac gtctttcttc
    1051  attaactgta ctgtgtcagc tctacctgct accatcacat acacgtctac
    1101  agggataaca tctgctactg tacaatgtac acgggccgtt agggccaaca
    1151  ccacttcatt gctttag