Sequence of DPV Apple chlorotic leaf spot virus
Apple chlorotic leaf spot virus CP gene for coat protein, complete cdcs, strain: GC10h.
ACC No: AB326229
Dated: 2007-08-17 | Length: 582 | CRC: -1123816788
ID AB326229; SV 1; linear; genomic RNA; STD; VRL; 582 BP. XX AC AB326229; XX DT 19-JUN-2007 (Rel. 92, Created) DT 17-AUG-2007 (Rel. 92, Last updated, Version 2) XX DE Apple chlorotic leaf spot virus CP gene for coat protein, complete cdcs, DE strain: GC10h. XX KW . XX OS Apple chlorotic leaf spot virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Flexiviridae; OC Trichovirus. XX RN [1] RP 1-582 RA Yoshikawa N., Yaegashi H.; RT ; RL Submitted (15-JUN-2007) to the EMBL/GenBank/DDBJ databases. RL Nobuyuki Yoshikawa, Iwate University, Faculty of Agriculture; Ueda 3-18-8, RL Morioka, Iwate 020-8550, Japan (E-mail:yoshikawa@iwate-u.ac.jp, RL Tel:81-19-621-6150, Fax:81-19-621-6150) XX RN [2] RA Yaegashi H., Isogai M., Tajima H., Sano T., Yoshikawa N.; RT "Combinations of two amino acids (Ala40 and Phe75 or Ser40 and Tyr75) in RT the coat protein of apple chlorotic leaf spot virus are crucial for RT infectivity"; RL J. Gen. Virol. 88:2611-2618(2007). XX FH Key Location/Qualifiers FH FT source 1. .582 FT /organism="Apple chlorotic leaf spot virus" FT /sub_species="Plant virus" FT /strain="GC10h" FT /mol_type="genomic RNA" FT /db_xref="taxon:12175" FT CDS 1. .582 FT /codon_start=1 FT /transl_table=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:A6BMF8" FT /db_xref="UniProtKB/TrEMBL:A6BMF8" FT /protein_id="BAF64471.1" FT /translation="MAAVLNLQLKVDADLKAFLAAEGRPLHGKTGAILEQTLEAIFANI FT AIQGTSEQTEFLDVTVEVKSMEDQKVIGSFNLKEVVNLIKIFKTTSSDPNINNMTFRQV FT CEAFAPEARNGLVKLKYKGVFTNLFSTMPEVGGEYPELMFDFNKGLNMFIMNKAQQKVI FT TNMNRRLLQTEFAKSENEAKMSSVTTDLCI" XX SQ Sequence 582 BP; 187 A; 116 C; 143 G; 136 T; 0 other; ab326229 Length: 582 17-AUG-2007 Type: N Check: 8524 .. 1 atggcagcag tgctaaatct tcagctaaaa gtggacgcag atctgaaagc 51 gttcctggcc gcagaaggca gaccccttca tggaaagaca ggggcaatac 101 tggaacagac attggaggcc atcttcgcga acatagcaat ccaagggacc 151 tcggaacaga cggaattcct cgacgtgaca gtggaagtca aatccatgga 201 ggatcagaag gtgataggtt ccttcaatct gaaggaggtg gtcaatttga 251 taaagatctt caagactaca tcttcggatc cgaacataaa caacatgact 301 ttccgccagg tctgtgaggc ttttgcccca gaggcaagaa atgggctggt 351 caaactgaag tacaaagggg ttttcacaaa cctattttct actatgccag 401 aagtcggagg ggagtacccg gagctcatgt ttgatttcaa taaagggctg 451 aatatgttta taatgaacaa agctcagcaa aaggtgataa ctaatatgaa 501 tcggcgtctt ttacaaactg aatttgcaaa gagcgaaaat gaagcaaaaa 551 tgtcatctgt tacgactgat ctttgcattt ag