Sequence of DPV Grapevine Algerian latent virus

Grapevine Algerian latent virus gene for coat protein, complete cds, isolate: Limo-08.

ACC No: AB461854

Dated: 2009-04-11 | Length: 1131 | CRC: -1282235184

                ID   AB461854; SV 1; linear; genomic RNA; STD; VRL; 1131 BP.
XX
AC   AB461854;
XX
DT   25-MAR-2009 (Rel. 100, Created)
DT   11-APR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Grapevine Algerian latent virus gene for coat protein, complete cds,
DE   isolate: Limo-08.
XX
KW   .
XX
OS   Grapevine Algerian latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1131
RA   Fujinaga M., Ogiso H., Wakabayashi H., Morikawa T., Natsuaki T.;
RT   ;
RL   Submitted (24-SEP-2008) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Masashi Fujinaga Nagano Vegetable and Ornamental Crops Experiment
RL   Station; Omuro, Nagano 381-121, Japan
XX
RN   [2]
RA   Fujinaga M., Ogiso H., Wakabayashi H., Morikawa T., Natsuaki T.;
RT   "First report of a Grapevine Algerian latent virus disease on statice
RT   plants ( Limonium sinuatum ) in Japan";
RL   J. Gen. Plant Pathol. 75:157-159(2009).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1131
FT                   /organism="Grapevine Algerian latent virus"
FT                   /host="Limonium sinuatum"
FT                   /isolate="Limo-08"
FT                   /mol_type="genomic RNA"
FT                   /country="Japan:Nagano"
FT                   /db_xref="taxon:208084"
FT   CDS             1. .1131
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="coat protein"
FT                   /protein_id="BAH30150.1"
FT                   /translation="MALALNTRRNNNGKVMEMLAYKAATAGAELALANVGSITRGVAQL
FT                   GKSMMGKKKRNKNVSQVGALGGAVVAPVAVTRQIRGSKPRFSGRGTGSITVTHREYLGQ
FT                   VVTTADLQVNGGITGNLLKVNPLNGILFSWLPTIAAGYDQYAFNRLSLQYVPLCATTAT
FT                   GRVAMYWDKDSTDLEPTDRVELANQAILKETSPWAEANLTIPTDRIKRFCDDSAVADRK
FT                   LVDLGQLGVATYGGTAVVAGDVFVSYTVTFYNPQPLATLMDTTRINASNTVITNVGPQY
FT                   SRIDVVSGNQWLITFRGVGKFVIFGSIRGTGAVVLALSGVIVNSSTTLTTPTGAMYVAN
FT                   VTVSSLPASVSYTMTTVTAGLHSAVRATRANDMGTP"
XX
SQ   Sequence 1131 BP; 303 A; 262 C; 300 G; 266 T; 0 other;

ab461854 Length: 1131  11-APR-2009  Type: N  Check: 5876  ..

       1  atggcattag cactaaacac aagacggaat aacaacggta aagtgatgga
      51  aatgttagca tataaagcgg ccacggctgg cgctgagttg gctctcgcca
     101  atgtcggtag cataacccgt ggtgtggcac aattgggtaa gagcatgatg
     151  ggaaagaaga agaggaacaa gaacgtatcc caagtgggtg cattaggtgg
     201  ggcggttgta gcccctgtgg cggttaccag acaaatacgt gggtctaaac
     251  ccaggttttc cggcagggga actggtagca ttactgttac acatagagag
     301  tacttgggcc aggtagtcac gacggcggac ctacaagtaa acggaggcat
     351  tacgggcaac ctactgaagg taaatccatt gaatggaata ctcttctctt
     401  ggttaccaac tattgcagcc ggttatgacc agtatgcctt caataggcta
     451  tcattgcagt atgtaccctt gtgtgcaact acagcgactg gtcgtgtagc
     501  gatgtattgg gataaggatt ccacggatct ggaacccact gatcgagtcg
     551  aactggccaa tcaagcaatc ttgaaagaga cgtcgccatg ggcagaagca
     601  aacttaacta tacccactga tcgcatcaag agattctgcg atgatagtgc
     651  ggtcgcagac cgtaaacttg ttgatctcgg acaacttgga gtggctacat
     701  atggggggac agcggtggtt gccggggatg tgtttgtcag ttacactgtc
     751  acattctata atccacagcc tctggccacc ctcatggaca ccacgcgtat
     801  caacgcctca aacaccgtaa tcactaatgt gggacctcag tattcacgga
     851  tcgatgtagt gtcaggcaac caatggctga taacctttcg gggtgttggc
     901  aagtttgtca tattcggtag tatacgtggc actggggctg tcgttttagc
     951  cctaagtgga gttattgtca actcctccac tacccttacc acacccacgg
    1001  gagcaatgta tgtggctaac gtgaccgtat catcattacc ggcaagcgta
    1051  tcatacacca tgaccactgt cacagctgga ttacattcgg ccgtccgtgc
    1101  gacaagggca aatgatatgg gcacacctta g