Sequence of DPV Citrus tristeza virus

Citrus tristeza virus, complete genome.

ACC No: AF001623

Dated: 2005-04-15 | Length: 19249 | CRC: 1431799283

                !!NA_SEQUENCE 1.0
ID   CTAF1623   standard; genomic RNA; VRL; 19249 BP.
XX
AC   AF001623;
XX
SV   AF001623.1
XX
DT   19-MAY-1997 (Rel. 51, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Citrus tristeza virus, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19249
RX   DOI; 10.1023/A:1008127224147.
RX   MEDLINE; 20007030.
RX   PUBMED; 10541017.
RA   Yang Z.N., Mathews D.M., Dodds J.A., Mirkov T.E.;
RT   "Molecular characterization of an isolate of citrus tristeza virus that
RT   causes severe symptoms in sweet orange";
RL   Virus Genes 19(2):131-142(1999).
XX
RN   [2]
RP   1-19249
RA   Yang Z.N., Mathews D.W., Williams A., Dodds J.A., Mirkov T.E.;
RT   ;
RL   Submitted (29-APR-1997) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology and Microbiology, Texas A&M Agricultural
RL   Experiment Station, 2415 E. Hyw 83, Weslaco, TX 78596, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19249
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="a severe stem pitting isolate from California"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="SY568"
FT   5'UTR           1. .107
FT   CDS             108. .9455
FT                   /codon_start=1
FT                   /db_xref="GOA:O10467"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="UniProt/TrEMBL:O10467"
FT                   /note="p347; contains putative domains for two papain-like
FT                   leader proteases, a methyltransferase, and a helicase;
FT                   similar to p349-kDa and p346-kDa polyproteins of CTV-T36
FT                   and CTV-VT"
FT                   /function="replication"
FT                   /product="347-kDa polyprotein"
FT                   /protein_id="AAB57702.1"
FT                   /translation="MSKLGARFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTETTTKV
FT                   VKEFSAPMPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVIDTSGVVRPR
FT                   SVAGIWRYSLCKPPLTAAAKKSXRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVMK
FT                   RVDPTMHESPQDEIKHKGRRHGKTSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIS
FT                   FGTVPTTAWCSPAEAAVLRCRIDYHAAETSFRNEGKHVRYVYNDVXSAANRPRTVSPRK
FT                   CGRVFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKALGAKVRCLWESSDLDDARI
FT                   RDGHCYVRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRESLKVPMRGTY
FT                   TFGSVFHCLSTKSCVDLRSIPNHHLVGGASAHVFIGQIRVDVPGGVTKPSRAAIRRRNR
FT                   RLREDGFLSNTGSSSSGGSRYCSDCSTPRSPPSPSIVGPTLGRIPSINRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTXFENGDDFAVIRRASAG
FT                   GLHVFVKRGNFTARFPMSASRYEHHYDASMKGAGLSWVRKSRFPNVEVIRRRRSRTGGS
FT                   LASFPDANLRINSDQPSDSVQAVPVSGENSPSSRGASSPRRDPVEGSGWYKVGSPSHHS
FT                   SAARGQRSTERRKIGDFSFPSNTVYNAXVDERAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGK
FT                   LLQLDSYGFSEDLKDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYG
FT                   KRAVEYGVRGYFSATRLYHCCFTDSPRPFKSLNMYHKMGGEEGALLITDTDRLRAVGSA
FT                   YEKVKGRLPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEF
FT                   NINFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGVHVCRPVY
FT                   XIKDAHRRVVRHHQLSKVAFDHTDGSKQVGAVNTNTVCGNVLGECFHASDAIVMVQVYD
FT                   VPLQELCRAMVNKKASVCYMTVVTPGELLDARESFFIKELDCSVELDTVADRVVYCFNN
FT                   SAYTHTYSTICEYMRTPCVVVDSFLFTIEMVSLRCSVNYYCITKSRVCPRISEIKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAXFSGD
FT                   XSLFELVRFAISEKCRDLFLGIQEAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPIDLPGFGCITEEDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDEESLG
FT                   GDGSDSLIGSGSDSPSNASSGGLRAGAAPSLFRSLLKKLGGGFCMAKRLLDLLCERLVA
FT                   SLSRLKFGTTHLTSLFSMLRIKLSRNFFDDSIFTAVWDTVMNLTRIVNGVTKTKLECFR
FT                   NVLRLIPKLCSGCKDLAKDFADMCRLVFLLSTEFFSKSYAKLCRFSLEIFDIGLIEISA
FT                   RNMGLETCVSMASAIFDVILTYPLGSISFPIVCARVFGALAMEVGSNYCFKKTFGKPEI
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDGKGLVRCSGVIPGILRIVLSSLFSDVDAWVGYSK
FT                   HEVSSLPMITYSAKRLSFVLEQAKEACIAFIVDSSKKILASLTSEIHESFQNSELTSGA
FT                   KSLYGHVSSILSASNGVVNKAGNAVAAVKAAGSGLSKRVRRIRPSFRLARCVNEQTSEY
FT                   YSASDESELDESLLSDTPGLRGNGKCSDLFRVVSGRVSICCRHAVEALRRLALHVGDYL
FT                   YSCIMDSFVRLFVRTNTAVGKCESFAVDCATKISDLVVGYIAWRNLHSGAYSTTPGLSG
FT                   GSRNSLSRFLDGGVMCVIQNLGTAWQTVFNETFYSSLAHRMRTASINVLLEFLKNLPVC
FT                   LVSIYTXIECRSRIFPLKEFLWGFCVFVWNIVKXLSICIYGSLPVCVTRLCNRVFRRSS
FT                   NEGDVRTLQVITEAENRIGFLREVLAEMARYRASLEIPVPGSPDXPLFPPTYGEIEELG
FT                   NDSSDSARVIGVDNGSDSVPTEGEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFR
FT                   LGLRFVWKMLRNSFNLRAVKFFYGLALQCXFNGGSMGQFTSRLLFSFGNCLPFEFFRHV
FT                   CSVRWLSKSLALRVRNASICDEETVERFFSFSRFLYDSRYLSDVFSVLEXVDFYLSYLF
FT                   SLPKRCLTRNRSVRVCARAPVRVIRDVGLVEDGKKSLTEVLNSLDSLKVSDRKGKSALI
FT                   ESDNSDSESGRSFGSISFGSVNEEVLEAVNGGVVSEKAPLMKHAAALSRLEPDLSGNKD
FT                   LPIVRRSFTRGESSGTKPAGSLCVYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFY
FT                   YSQKVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVSVVDFNLKVIVGRHGTRPFR
FT                   NTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSL
FT                   IVYEAPPGGGKTHSLVKYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHV
FT                   VKTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQI
FT                   HYIHRNDFGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSIG
FT                   KSSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPIVNTVHEVQ
FT                   GETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEARE
FT                   IFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGD
FT                   TSEELSSRPFESGCDNXTXRDTAPPDSGNLHEPARVRRXKVAXNSAKKSVPTRKSSVVR
FT                   KS"
FT   CDS             <9328. .10812
FT                   /codon_start=1
FT                   /db_xref="GOA:O10468"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:O10468"
FT                   /note="RdRp; similar to RNA polymerases of other
FT                   closteroviruses; it is presumably expressed via a +1
FT                   ribosomal frameshift"
FT                   /function="replication"
FT                   /product="57-kDa RNA-dependent RNA polymerase"
FT                   /protein_id="AAB57703.1"
FT                   /translation="GTLXPXXXVIYTNRLXFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPEXFGRAMAAAVIERCFXMDEVAKIRSDIIALTEANIQKWLDKRTPCQVK
FT                   XVQAELKLPFXVEEQITNYKLMVKRDAKVKLDDSSLSXHPAAQNIMFHKKFINAIYSPC
FT                   FDEFKNRVLSSLNGNIVFFTEMTNAGLAEVIRRIIGDDDBLFVGEVDFSKFDKSQDLFX
FT                   KEYERALYXEFGFDDELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQYKLTDDELFELFTSFKDXTQDFGDQVVLEKLK
FT                   LLVEXKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERVVYDNRVGYFSYFDNXFXKPDXSDGQXDDLXTX"
FT   CDS             10861. .11772
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR010803"
FT                   /db_xref="UniProt/TrEMBL:O10469"
FT                   /function="unknown"
FT                   /product="33-kDa protein"
FT                   /protein_id="AAB57704.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKT
FT                   VDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAVSKTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11842. .11997
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009584"
FT                   /db_xref="UniProt/TrEMBL:O10470"
FT                   /note="p6; small hydrophobic protein; probably
FT                   membrane-associated; similar to small hydrophobic proteins
FT                   of other closteroviruses"
FT                   /function="unknown"
FT                   /product="6-kDa protein"
FT                   /protein_id="AAB57705.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             12003. .13787
FT                   /codon_start=1
FT                   /db_xref="GOA:O10471"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="UniProt/TrEMBL:O10471"
FT                   /note="p65; similar to HSP70 family of heat shock proteins"
FT                   /function="putative chaperone"
FT                   /product="65-kDa protein"
FT                   /protein_id="AAB57706.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVTVEEFGTKSVP
FT                   VPYLSPLNNDLGLNVALPLLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFIPQKELNVSSLKEALSLQTDPVKYTVTHHG
FT                   MSETISIDQTALREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LATVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSRYDYTGMPHPTRNLVKLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRRTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13711. .15318
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProt/TrEMBL:O10472"
FT                   /note="hypothetical p61"
FT                   /function="unknown"
FT                   /product="hypothetical 61-kDa protein"
FT                   /protein_id="AAB57707.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKNDDYFNLITPMFNCLVKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVGLRWAGMFVYYGVYRCAIDRVVERPTLFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYNTS"
FT   CDS             15293. .16015
FT                   /codon_start=1
FT                   /db_xref="GOA:O10473"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:O10473"
FT                   /note="diverged copy of the coat protein that exists at one
FT                   end of virus particles"
FT                   /function="unknown"
FT                   /product="27-kDa protein"
FT                   /protein_id="AAB57708.1"
FT                   /translation="MAGYTTLPNTDDKEMNPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEXLKYVMVTMDXFLLENYKTKTEDLLVHLAMIQKRLCTX
FT                   STSTKTKFRDKGCISYVQGGXRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLXGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16107. .16778
FT                   /codon_start=1
FT                   /db_xref="GOA:O10474"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:O10474"
FT                   /product="25-kDa coat protein"
FT                   /protein_id="AAB57709.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16744. .17247
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR008452"
FT                   /db_xref="UniProt/TrEMBL:O10475"
FT                   /function="unknown"
FT                   /product="18-kDa protein"
FT                   /protein_id="AAB57710.1"
FT                   /translation="MSGSLGNLTHVDLLRCDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDCLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNADDSRCGCSIWFYNNGTFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17281. .17640
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009692"
FT                   /db_xref="UniProt/TrEMBL:O10476"
FT                   /note="p13"
FT                   /function="unknown"
FT                   /product="13-kDa protein"
FT                   /protein_id="AAB57711.1"
FT                   /translation="MGIRRVWLKIMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELAKFDLDFLRIVIIPLSGGAVNESHADRTNVSEIVESHMSDRDRMKILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17716. .18264
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProt/TrEMBL:O10477"
FT                   /note="hypothetical 20-kDa protein has a homolog in the
FT                   genome of beet yellows virus"
FT                   /function="unknown"
FT                   /product="20-kDa protein"
FT                   /protein_id="AAB57712.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18347. .18976
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProt/TrEMBL:O10478"
FT                   /note="putative RNA-binding protein; detected in tissue
FT                   extracts from CTV-infected citrus"
FT                   /function="unknown"
FT                   /product="23-kDa protein"
FT                   /protein_id="AAB57713.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNNYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18977. .19249
XX
SQ   Sequence 19249 BP; 4717 A; 3796 C; 4851 G; 5687 T; 198 other;

AF001623  Length: 19249  April 19, 2005 08:52  Type: N  Check: 9626  ..

       1  aatttctcaa attcacccgt accctccgga aatcacgtcc ggacgctgcg
      51  ggaatcggtg taaatcccgg caaattgccc cactacggcc atacaaacaa
     101  caacaatatg tcgaaactcg gagctcgctt caagtcctcg actttcgctg
     151  tacgcagcga ttacatcatc tcgcgcatct ggcgcgcctt taacaccgtt
     201  ggagtcctgc acttcttcgg tactgaaaca accaccaagg tggttaagga
     251  gttttcggcc cctatgccga tagtcccttt acggaaatcc tgttttccgt
     301  tttctgttcg cgctgctgtt cgcgcgatta aagctgccgg acgtcctatt
     351  gacgctccgc gctccggatg cctctgtggc ctccctgtta tcgacacatc
     401  tggtgtcgta cgtccccgct ctgtcgcggg catttggagg tattctctgt
     451  gtaaacctcc ccttactgcc gccgccaaga agtccaytcg caaggcgaag
     501  aaagattctg ctttctttct cagccgggct tcttcactct tctcacggga
     551  agtcccctgc ggcacgcgtc atagacttcg taggcgcgtt atgaaacgag
     601  tagaccccac catgcacgag agtccccaag acgagatcaa acataaggga
     651  cgccgacatg gcaagacttc tgacctcccg tatatggggg aagcagcgtt
     701  ggatgatatc cttcgctgga ttgagggggt aaatcccccg ccgtcgatgg
     751  tcgccattcc ggtgcccatc tctttcggca ccgtgcccac aacggcatgg
     801  tgctctcctg ctgaagcggc tgttttgcgg tgtcgcatag actaccacgc
     851  cgctgaaact tcctttcgta atgaagggaa gcacgtgaga tacgtctaca
     901  atgacgtgyc ttctgctgca aaccgtcctc gtacggtttc tccccgcaag
     951  tgcgggcgtg ttttccccag cggttctgcg ctgggtgttg aggtcccgag
    1001  cactagggat cgccataccg ctttcgtgag atctactcac gctagcgtct
    1051  tcttctccga cgcggttcgc cgcgttcgca tgttccgtcc tgggcggaat
    1101  aatttcttca ctagcgtcgt cagtgggcgg cgcgttagtt actttagacc
    1151  cggacctaat ggtacggtgt ctgttttaat gtcggacggt gtcaacacgg
    1201  cgcgtctcga cgttgtcgct cctgcgtact atgcgtacgc taaagcgtta
    1251  ggcgccaaag tgcgctgttt gtgggagtcg tccgacttgg acgatgctag
    1301  aatacgtgac ggccattgct acgttcgtca cgtgtacgac gtggcccttt
    1351  acttcggaag gcgcgtcgat ctttctgtgc gccgaacttt gggtttgttt
    1401  cccacagtgg gtgcactaaa agcttatctt gttcgcgagt acggtcgcga
    1451  atcgttgaag gttccgatgc gcgggactta cacttttggc agtgtatttc
    1501  attgcctgtc gactaaatct tgtgtcgact tgagatctat tcctaaccat
    1551  cacttggttg gtggtgcgtc tgctcacgtg tttattgggc agattcgtgt
    1601  tgacgttcct ggtggtgtca ctaagccatc gcgagcagct attcgcaggc
    1651  gtaataggcg tttgcgtgaa gacgggtttt taagtaatac cggttcgtct
    1701  tcttcaggag ggtcgagata ctgttcggat tgttcaactc ctcgcagtcc
    1751  accctctccg tcgattgttg gaccaactct tggccggata ccaagtataa
    1801  accggaagtt ccggtttcca gcaggcactc agttgagtgt ttctatccct
    1851  aaacgcgatg acgatcgcgt gtacgtgtcg gtcggccaag actttgatga
    1901  gttgtgccat gccgtgtgta cctacgttaa gaggtacaac tcgagaaaag
    1951  ctttttacac gcrgtttgaa aatggtgacg atttcgccgt cattcggcgt
    2001  gcttccgccg gaggtcttca cgtgttcgtg aaacgcggca actttacggc
    2051  tcggttcccc atgtcggctt caaggtatga gcatcattat gatgcaagta
    2101  tgaaaggcgc cggtttgtcg tgggtgcgga agagtcggtt tccgaatgtt
    2151  gaagttatac gccgtcgaag gagtcggacg ggcggttctt tggctagctt
    2201  tccggacgcg aatttacgga ttaattctga ccaaccgtcg gattctgttc
    2251  aagcagttcc ggtgtcgggt gagaattctc catcgtctcg aggagcgtct
    2301  tcgccccgac gtgatcctgt tgaagggtcg ggctggtata aggtgggttc
    2351  tcctagtcat cactcgagtg ccgctcgtgg gcaacgttct actgaacgta
    2401  ggaagattgg ggatttcagt tttccgagta acaccgtgta caatgcackt
    2451  gtagacgagc gtgcttataa acgtgttttg aaattgcggg acacgtcggc
    2501  gtcctctttt cttcgtatag ttttggctcg tttgtcgagt tatcggcctc
    2551  ttagtgacga gttctttaac aagtgcgtta cttctcggtt tgtagcttgt
    2601  atcgaggcgg ttgaatcggg tctcgttaca gtacactttc gatccgacgt
    2651  gtttcgcgcc tcattcccgt ttggtgttta tttgtatact cgtcacgcat
    2701  ttgatattta cagtggtaaa ctcctgcaac tagatagcta cgggttttcg
    2751  gaagacctga aggacggcta ctgttatatt cgtcatattg ccgaggtctg
    2801  tttgagtatg ggaaaagttt tctttaggag ggacgttaac ttaggggcgt
    2851  tcccttatgt tttcgaggta caacaccgtc ttgagcggtt gtatggtaag
    2901  cgggctgttg aatacggcgt tagagggtat ttttcagcaa cgcgtcttta
    2951  ccactgttgc tttaccgatt caccgagacc cttcaaatct ttaaatatgt
    3001  atcataagat gggtggtgaa gaaggtgcgt tattaatcac tgacactgat
    3051  agattacgtg ccgtggggag tgcttacgag aaggtgaagg ggcgtttgcc
    3101  tgattcttta ctcgttcgat cagtggagaa agatttgata gaattcaatc
    3151  aaactctggt tgatacgcaa cgggctagac ccggtgttgc agtgcctttt
    3201  cagatgagtg agaaccaaca ggtgatgctc actagagctt atcctgagtt
    3251  taatataaac tttactcatt ccgtacactc cgatcacccc gtggctgcgg
    3301  gttctagaat gttggagaat caccttgttc gtaaatacgc aggtagcgat
    3351  tattcggacg taggtggttg cccattattt catttacgag cgggtcatac
    3401  aggagttcac gtttgcagac cagtgtacka cattaaagac gcccaccgta
    3451  gagtcgttcg tcatcatcaa cttagtaaag tagcttttga tcacactgac
    3501  gggtctaagc aggttggtgc tgtcaatacg aataccgtgt gtggtaacgt
    3551  tttaggggag tgttttcatg cgtctgatgc gattgttatg gtgcaagttt
    3601  atgacgtgcc attgcaagag ttgtgtagag ctatggtgaa caagaaagct
    3651  tcggtgtgtt atatgaccgt ggttacgcct ggtgagctgt tggacgcccg
    3701  tgagtccttc ttcatcaaag agttagactg ttcggtggag ttggacactg
    3751  tcgccgatag ggttgtctac tgctttaaca attcagcgta tacgcacacc
    3801  tattctacga tatgcgaata catgcgtact ccttgtgtag tggtggatag
    3851  ttttctgttt actatagaga tggtttcact cagatgtagc gttaactatt
    3901  attgtatcac caaatcgcgg gtttgtccga gaatcagcga gattaaacgg
    3951  ttacgctatc gtcggtgtga tagtgacttg attagaatta agattcctcg
    4001  gtactctagt aagactcgta gttgtttacc agggtgctat tacttgtatt
    4051  tggacgctaa gtttgtgagt cgtgtatacg aatacgtggt taataattgt
    4101  gttgtggtga atgctaagac ttttgaatgg acttggaact acatcaagtc
    4151  ctgtaagtcg agagtggtca tcagtgggaa gatcatccat agggacgttc
    4201  ctatcgcatt ggagtatttg gatgggtttt ccgcagttat gctgtccgcg
    4251  ggcgtgaaag gtaggcagaa cgcagaggcg ttttctaggc gtctagcggy
    4301  cttttcagga gacamttctc ttttcgaatt ggtgaggttc gccatttcag
    4351  agaagtgtcg tgacttattt ctgggcattc aggaggctgt ggagaggtgc
    4401  gtgaaatcat acctcagaaa ctcgtttaat atgagtttcg tagacttgtc
    4451  tgatcctctg ctcacyatca gtgagtactc rgagttagat gttcctattg
    4501  atttaccggg tttcggctgc ataacggagg aggacgaggc taaacttata
    4551  gaagatggag ttaagtcggc tttactgcgg aaagcagttc gtgacgaagc
    4601  acaactcatt ctcgaaaggg gcggcacgtc agagatcgtt ccctgtgggg
    4651  atgaagaaag tttaggcggc gacggttctg acagtttaat ygggtccggt
    4701  agtgattcgc cttctaatgc tagttctggt ggtttgcggg ccggagctgc
    4751  cccttcactg tttagaagtt tgttgaagaa gttgggtggg ggtttttgca
    4801  tggctaaaag gttgttggac ttgttgtgcg agcgattagt tgcttcgtta
    4851  tcgcgcctaa agttcggtac aactcattta acctcactct ttagcatgtt
    4901  acgtattaag ctttcgcgta atttcttcga cgactcgatt tttaccgctg
    4951  tttgggacac ggtaatgaac ttaactagaa tcgtcaatgg ggtgaccaag
    5001  acgaagttgg agtgttttcg caacgtcctt cggttaattc ctaagctgtg
    5051  ttctggttgt aaggacctcg cgaaagactt tgcggacatg tgtaggttag
    5101  tttttctgct ttctacggag ttcttcagta aaagctacgc taaactatgt
    5151  cggtttagtt tggaaatatt cgatatcgga ctcattgaaa tttcagcccg
    5201  taatatggga ttagagactt gtgtttcgat ggcttcggct atttttgatg
    5251  ttatacttac ctatcctctg ggaagtatta gctttcctat cgtttgcgcg
    5301  agggttttcg gcgccctcgc tatggaagta ggatcgaact attgttttaa
    5351  gaaaactttc ggcaaacctg aaattttagg agaggatgct ttccgtagaa
    5401  cggtaagtat ggtgttgagc gctaaggctt tcgacaaact ttcggtcgac
    5451  ggtaaaggtt tagttaggtg ttccggtgtt atacctggaa tactgaggat
    5501  agtgctctcg tctctgtttt ccgatgtcga cgcatgggta ggttatagta
    5551  aacacgaagt ttcctcgctt cccatgatta cgtatagygc gaaaaggttg
    5601  tctttcgtgt tggagcaggc taaggaagcg tgcatcgctt tcatagtcga
    5651  ttcgtctaag aagattttag catctttgac ctcagagatt cacgaatctt
    5701  tccaaaactc ggaattaact agtggtgcta aatccttgta tggacatgtg
    5751  agttctatac tctcagcgtc caatggtgta gttaacaagg cagggaacgc
    5801  cgttgcagcg gttaaagcag cggggagtgg tcttagcaaa cgtgtgaggc
    5851  gcattcggcc ttcctttcgc cttgctcggt gtgttaatga acagaccagc
    5901  gaatactact ctgctagtga cgagtctgag ttggatgagt cgttgcttag
    5951  tgacacaccc ggtcttcgtg gtaacgggaa gtgtagcgat ttgtttcgtg
    6001  tcgtttctgg acgtgtctca atatgttgta ggcacgctgt ggaagccttg
    6051  aggcgtttag ccctacacgt cggtgactac ttgtactcgt gcattatgga
    6101  ctcttttgtg aggttgttcg taagaaccaa cactgcagtc gggaagtgtg
    6151  aatccttcgc cgtcgattgt gccactaaga tttctgattt ggtagtcgga
    6201  tatattgctt ggcgcaatct tcattccggt gcgtattcga caactccagg
    6251  attatccggc ggcagtagaa attctctttc caggttcttg gacggcggtg
    6301  tcatgtgtgt aattcaaaat cttggtaccg cgtggcagac ggttttcaat
    6351  gagacctttt actcragcct ggcccatcgg atgaggactg cttcgataaa
    6401  tgtgttgtta gagttcctga agaacctccc ggtttgttta gtttcgatat
    6451  acactytcat agagtgtaga tctaggattt ttcctttgaa ggagttcctt
    6501  tggggctttt gcgtttttgt ttggaacatt gttaagraac tttccatatg
    6551  catttacgga agtctccccg tttgcgttac gaggttgtgt aatagggtgt
    6601  tccgtcgcag ttccaacgaa ggtgacgtgc gtacgcttca agtaatcacc
    6651  gaagccgaaa accgaatcgg gtttttgcga gaagttctcg ccgagatggc
    6701  acggtatcgt gcttctctcg agatacccgt accggggtcg cctgatrgtc
    6751  ctttgtttcc accgacgtac ggtgagattg aggagttagg taacgattcc
    6801  tctgacagtg cccgagtgat aggtgtggac aatggttcag attcagtgcc
    6851  cactgaaggc gaagcggaac tagattcgga tggtgatagc gatgattcaa
    6901  tacctttgga tcgcgacttt gagcaaatcg gaggtcttgg cggaagcggt
    6951  aacgttgacg tctttcgttt agggctgagg ttcgtgtgga aaatgttgcg
    7001  taattcgttt aacttaagag ccgttaaatt tttctatggg ttagctcttc
    7051  agtgtrtatt taacggcggt tcaatgggcc agtttacgtc gcgactgtta
    7101  ttcagtttcg gcaactgttt accgtttgag ttctttagac acgtttgtag
    7151  tgtgaggtgg ctgtcaaaga gcttagcact acgtgttcgt aacgctagta
    7201  tttgtgacga ggaaacggtt gaacgtttct tcagtttttc gcgatttttg
    7251  tacgattcgc gttacttatc ggacgtgttt tcggtgttgg agrgggtcga
    7301  tttttactta agttatctat tctcgttgcc gaagaggtgt cttacgcgta
    7351  accgtagtgt ccgagtttgc gctagagctc cagttcgtgt gattagggac
    7401  gtgggacttg tagaagacgg caagaagtct ttaaccgaag tgttgaactc
    7451  tttggactca ttgaaagtgt ccgaccgtaa agggaagtca gcacttattg
    7501  aaagtgataa ttccgactcc gagagcggtc gttcgttcgg ttccatttca
    7551  ttcggatcgg ttaatgagga agttttagaa gcagtgaacg gtggtgttgt
    7601  atccgaaaaa gctccactga tgaagcatgc ggctgcacta agcaggttgg
    7651  agccagatct tagtggtaat aaggatcttc ctattgtcag gagaagtttt
    7701  acccgcggtg aatcttcagg tacgaaaccg gcaggaagct tgtgcgtgta
    7751  cttaacgacg ttgaattctt cattcggttc ggtgcctgac ctgtatcccg
    7801  tcgcacgtga cataacgtac aagaagatga ccaacgccat gcgcgagttt
    7851  tattactcgc aaaaggtaac gttgtacgaa cttcacggaa aattgagctc
    7901  gtactgggat gaattaaaga cggtaggttt tgataggaag ttggcgaaga
    7951  tggatttaga cgatgacgtt agtgtcgtcg attttaactt gaaggtaata
    8001  gtggggaggc atggtacccg tcctttcaga aatactgtga actctcacga
    8051  gttcatgttt tgtgatgacg gattggtgct ttgcccgggt ccgaaaaagc
    8101  gtgactttgc tctgatctct agtcaaacgc aatttgttgc tgcgaactct
    8151  ttcctgcgtg ccgtggacgg taaagatttg acgttcacta attcggagca
    8201  tagtctcata gtttatgagg ctcctcccgg tggtggaaag acgcattctt
    8251  tggtaaagta tttcgccgat tattgtacca aagtgtcttg cttggtggtg
    8301  accgctaaca aaaattcgca agcggagatt tctcaaagaa tctctaggga
    8351  gttaatggat agaaagatgc ttgctaaaca cgttgttaaa accgccggta
    8401  gagtgttcac tgtggactct tatctgatga accatattcg actcaagact
    8451  gatttgttgt ttgtcgacga gtgttttatg gttcatgctg gagcaattgg
    8501  agcggttgtt gagttcactt catgtaaggc cgtggttttc ttcggtgata
    8551  gtagacaaat tcattatatt caccggaacg attttggtgt ttcattgttg
    8601  catgacatag acgcgtttat agaaccacag caccgcattt acggtgaggt
    8651  gtcctacagg tgtccttggg acatctgtga gtggttgtct aaattctatc
    8701  cgagacacgt ggccactgct aacactggta gtatcgggaa atcgagtgtg
    8751  tctatagaga taattaatgg ctgtgacgat gttccttacg atagtagcgc
    8801  gaagtacatc gtttacacac aagcagaaaa gaacgaactg caaaagcacc
    8851  ttggtcgttt aaccgtaggc cgaactaaag cggtgcctat tgtgaacaca
    8901  gtgcatgaag ttcaaggtga aacatataag aaggttcgtt tggtaagatg
    8951  caaataccaa gaggacactc ctttctgttc agataatcat gttgttgtgg
    9001  ctttaaccag gcacgtcgac tccttaactt actccgtttt gaatagcagg
    9051  agatacgaca agaccgcttc cagtatagat gaagcgaggg agatttttga
    9101  caaatttcgt tcgacgaacc attctcacgg ttcttcgacg ttggaatggt
    9151  accttgagaa ataccctact gaatataagg gtagtaaagc atcttcggcg
    9201  ccgttaagtt gtattaacga gtttcttaac gaggtcgttg tcggttcttc
    9251  agttgtgcag ttgggagaya cttcwgaaga attragttct cgycctttyg
    9301  agtctggrtg tgacaatrtt accrtaaggg acactgcwcc cccwgaytcw
    9351  ggtaatytac acgaaccggc tcgygttcgg cgtrgtaagg tcgcargcaa
    9401  ttccgccaag aaaagcgtcc ctacaagaaa atcttctgtc gtacgaaagt
    9451  cgtaattaca actttataaa gacrgagcgr tttgtggggc cygaawrttt
    9501  tggyagagcy atggctgcgg ctgttattga gaggtgtttt argatggayg
    9551  aagtggccaa gataagaagc gayattattg ctttractga agccaatatt
    9601  caaaaatggc tcgataarcg tactccgtgt caggtraaak ctgtgcaggc
    9651  ygaaytgaag ttaccgttyg mtgtggaaga gcaaatcacy aactacaaac
    9701  taatggttaa gcgtgaygct aaagtaaagc tcgatgattc gagtctktcc
    9751  magcaycctg ccgcrcagaa yattatgttt cataagaart ttatyaaygc
    9801  tatttattct ccatgcttcg aygaatttaa gaatagrgtg ttatcgtcac
    9851  taaacggtaa tatagtkttc tttacygara tgacgaacgc tgggttggcg
    9901  gaagtyatya graggattat aggygatgac gayraycttt tygttgggga
    9951  agtggatttc agyaarttcg ayaagtctca agatttgtty rtcaaggagt
   10001  aygagcgygc rttatactyt gagttcggrt ttgatgacga acttctygac
   10051  gtgtggatgg aaggcgagta ccgcgctagg gctacyacgt tagacggtca
   10101  gctgagtttt tcggtcgacg gtcaacgycg ttcgggaggt tcgaacacrt
   10151  ggattgggaa ctctttggtt acyctrggta tcctatcytt gtaytaygac
   10201  gtctcaaagt tcgagctact rctyatwtct ggygacgact ctctgatcta
   10251  ttcaaaagaa aagatyagta acttttcttc agaaatttgt ctggagacrg
   10301  gttttgaaac taagtttatg tctcctagcg taccrtactt ttgttcgaag
   10351  ttygtggtwc aracwgggaa caaaacrtgt tttgtrccgg acccttacaa
   10401  gytrttggtt aaactggggg ctccycarta caaattracy gaygaygaac
   10451  tyttcgarct gttcacttcy tttaaagaya wcactcagga ctttggtgat
   10501  caggtggtcy tagagaaatt gaagttgtta gtagagayta agtacggytt
   10551  tacyagcgga actactatgc cygctctrtg tgctatacat tgygtacggt
   10601  cyaattattt rtckttygar aggttgtttc cctttatyag rggttggtat
   10651  gttgtcgayg ctttgaagct tagacaactr aggaarttcg ccaatttgat
   10701  ctgtgaacgy gtggtttacg ataatcgcgt gggttatttt tcgtactttg
   10751  acaatmcgtt trctaaaccc gayrctagcg atggtcaary ggaygacttr
   10801  rygacwgrtt gatmgtttgt tcaattctcg ctgagagcca acgttggtag
   10851  ttgagtcgag atgtttgctt tcgcgagcga aaatcaagac ttattagaag
   10901  aaaagatatt tcgtcgtaga acgtaccatc gtaagtattt cgatgatgtg
   10951  gttagggatt ttactatcga tgttggttac gatattgttg atcgtgaccc
   11001  tacggtattg gctgactatt tctcgttata tttctttctg cttaacaacg
   11051  ataacgttgg gcctttagcg gcttcaattg tggtgagccc gccggttaac
   11101  gggactcata aaattcgagc gcacgtcgat aatcaaccaa attgcgaagg
   11151  aaacgtgact tacattaaaa ctgtcgataa gagtcgtttt gcgattctca
   11201  taaaggcagt cccggctcct atgagaggtt attactcttt tcgggcgttt
   11251  cttgccgctg atgtcactag cgaacgcagt gaattcatat gcagttttgt
   11301  cggtagtaga ttcctttgtt gttgtacgca aacgatatcc gaaaatttga
   11351  gtaaggtttg ttcgtcttct ttctctttta gagccgtctc aaaaaccgca
   11401  attaacgagt tttctgttgc gattgatgat gtggaagacg ttaagtatgt
   11451  gagaaagcga gctgagggtt tctcacattg cgccgaccca taccccccta
   11501  ggtgttatcg cggcactaat ttaggcgatt cttcaggggt tcaaagtcgt
   11551  acaatcgagg aagaaggtta taggacagat accgcaggta acgtcgcggt
   11601  ctctatcccg aacaccccac tcgttaatgc tgtctctccg tatgtcgcag
   11651  agtacaacga aaatacgcgt tcgcgtatct cgttgatacg ccgagtctgt
   11701  tgttacgctg tttgtgtttt agtggtgtct cttcttataa tgagcggttt
   11751  gttagccatt atattcatat gatttgatga agtaaattac gaggtgcaat
   11801  tagctaaaac tcaccgtttg actctgttta aacgggtttc aatggactgt
   11851  gtgattcaag gatttttgac ttttctggtt ggtatagctg tgttttcggc
   11901  ctttgccgga ctgattatca ttgttataac gatttatcgg tgcacgacta
   11951  agcctgttag gaacacttct ccttacggca ctcacgccac tgtctaagcg
   12001  gtatggtact tctgggttta gactttggta ccacgttttc gacggtggct
   12051  atggctacat cctctgagtt agttatactc aaacaatcta attcatcgta
   12101  catacctaca tgtttgtttt tgcatgcaga ccctaacagc gtgtcttatg
   12151  gttacgatgc ggaatattta gcggcttctg gggagcctgg ttctttttac
   12201  aaagatttga aacggtgggt tggttgcact gcgaagaact accaaaccta
   12251  cttacacaaa ctatcgcctt cctataaggt gacggtggaa gagtttggaa
   12301  ctaagagtgt gccagtccca tatttgtcac ctctgaataa cgatttggga
   12351  ctcaatgtcg ctttaccttt actaatcgct tcgtatgcca aatccatttt
   12401  gtcggatgcg gaacgagtgt tcaatgtaag ctgcactgga gttatatgtt
   12451  cggtacccgc tggttataac acgttgcaac gagcttttac gcagcagagt
   12501  atatcgatgt cgggttactc ttgcgtgtac attattaacg aaccttcagc
   12551  agccgcgtac tccactctac ctaagttgag ttcggcagat aaatatttag
   12601  ccgtttacga cttcggcggt gggactttcg acgtctctat agttagcgtc
   12651  agattgccta cgttcgccgt taggagttcg ggtggtgaca tgaatttagg
   12701  tggtagagat atcgacaaaa agttatctga taaaatatac gaaatggcag
   12751  attttatacc gcaaaaggaa ttgaacgttt ctagtttaaa ggaagcttta
   12801  tctcttcaaa ctgatccggt caaatatact gtaactcatc acggaatgag
   12851  tgagacgata tcaattgatc aaacggcgtt gagggagata gcttcggtgt
   12901  tcataaatcg aacgatagat atacttacgc aagttaaagt taagtctagt
   12951  atgcccgaat cgcaaagttt aaagttagtg gtagtcggtg gaagctcgta
   13001  cctaccagga ttgttggata ctttggcaac cgtgcctttc gtgtctggga
   13051  tagtaccagt ggaagacgca agaaccgcgg tcgctagagg gtgtgcttta
   13101  tatagtgagt gcttagatgg taggtccaag gccctactaa tagattgtat
   13151  tacacatcat ttgtcggtta cgacgtttag cgcggactcg gtcgttgtcg
   13201  cagcggccgg tagtccaatt ccttttgaag gagaacgaaa actcacgtta
   13251  cgcaaatgcg ttagcacgtc taactatcaa gcaagaatgt ttgaaggaga
   13301  ttacgaaaag gttttccgaa atgaacgtat ctacgcagct tcagtatcgt
   13351  tgtttacttt aggagttaat tggcgtgtgc ctaacgacgt tgaaatgact
   13401  ctcgtgacca aagtggactc aatgggtaaa gtggaatttt accttaaagg
   13451  tccatctggt gaactagtca acgtgcaagg tacttcgcgt tacgattata
   13501  ctggtatgcc tcaccccact agaaatttgg tgaagcttag cgattacaat
   13551  gtaaactccg ccgctttagt tttagctttg acattaactc gcgaaaaacg
   13601  agaaaagttt cttttgcgga cattatttga cactttacta gcagatttgc
   13651  gaaggacagc aagtttaagc gagtactcaa agaagtaccc gatcactcga
   13701  aacgatatcg atgtcgtctc atcacgtatg gggatcgttg tttcgaaagt
   13751  tttacgggga agcgatttgg aaagaatacc tctctgaatc aactcgaagt
   13801  tttgatgaaa gaaacgtgtc gttggaccac actttgagtt cgggtgtggt
   13851  cgtccgtagg cagagtcttt tgaatgcgcc tcaagggact ttcgagaacg
   13901  agttagcgct attgtataat tcggtggtga ttaacgattt tgttgagttg
   13951  actggtatgc cattgaagtc tttgatgaca ggtatcgagg accgtaaggt
   14001  gcctgacgaa ttaatatccg ttgacccgca cgaagtcgga tgtagattca
   14051  cgttaaacga cgtggaatca tatctaataa gcaggggcga ggattccgcc
   14101  gatgtaacgg cggtcgagca ttcgtggtgt ttgagtaact cttgtggtag
   14151  actattaagt tcgaccgaga tagatgctta caaaaccttg gtgtttacca
   14201  agaattttga tagtaatgta tctggagtga ctactaagtt agagacttat
   14251  ctatcgtact gtatatcttt gtacaagaaa cactgcatga aaaacgatga
   14301  ttattttaat cttatcacac ctatgtttaa ttgtttggtg aaagtgctgg
   14351  cgtcacttgg tttgttttat gagaaacata ctgacaatcc gctactgacc
   14401  ggaatgctta tagagttttg cctagaaaat aaggtgtatt actctacttt
   14451  taaagtaaat ttagacaacg ttagattgtt taagtctaaa gtgttgcctg
   14501  tggtgttaac ggtttgggat atatctgagc ctgatgaccc agtggatgaa
   14551  agggtgctaa ttcctttcga tcctactgat ttcgtgctcg atttacctaa
   14601  attgaatata cacgacacaa tggtggtggt gggtaatcaa atcagacagt
   14651  tagagtacgt agtcgagagc gatgctttag acgatttatc tcaacacgtt
   14701  gacatacgtt tagcagcgga caaccccgat ctacgcgttg gtctgcgttg
   14751  ggcagggatg tttgtctact acggtgttta tcggtgtgct attgatagag
   14801  tggtagaacg accgacgtta tttagattgc cgcagaagtt attgagtcag
   14851  gatgatggcg aatcgtgctc attgcgcatg agtgccgtcg aagctttatt
   14901  taatctagtg caaaaggtga acagggacat aaacgttaga cgtcagttca
   14951  tgggacgtca cagtaaagtg gctttgcgac tgtatcgcaa cttaggtttg
   15001  aggtttccac cgatctcttc agttaggtta ccggttcatc acggttactt
   15051  atacgtcgat ttttacaaaa gagtacctga cgatgctgtt actgccgacg
   15101  aactcgaaag tttacgtcaa ttacgttcgt ccgtggacgt tatgtgtaag
   15151  gacagggtgt caatcacacc tccaccattc aatcgactta gaagaggttc
   15201  ttctagaaca tttagaggtc gaggcgcacg cggtgcgagc tcgcgtcata
   15251  tgagcagaga cgtggcaact tccggtttta atttacctta tcatggcagg
   15301  ttatacaaca cttcctaata ccgatgacaa agaaatgaat ccggtgagtg
   15351  ccgctgtacc cggtaagtat ccggatgtca ttgaaaaatt tgtggccaac
   15401  aggtccgtag acgcgttaat agaaggygty atwagtaagt tggatacyaa
   15451  ttcaatatac gaagattcca ctgaaaaatt tactggtgar camttgaart
   15501  acgtyatggt tactatggay rctttcttay tagaaaayta caaracgaaa
   15551  acggaagatc tgytggttca cttrgctatg atycaaaaga ggttgtgcac
   15601  tayatcyacg agyactaaaa ccaarttycg ygataaaggt tgtatyagtt
   15651  acgtgcaagg gggttyrcga tataagttaa tggataargt rgtttttcct
   15701  ttcattatat ckaartttac cgacagggag actccraacg ctctacgtaa
   15751  gtatgcttgy actttygagg agttacactt gtgyatggct aggytgagac
   15801  ccgacttata cgaaaayaaa aggacgacya aagcygggac tccrcattta
   15851  aarggctayt tatcagcyga ytttcttwcg ggttcyctcc caggrtactc
   15901  cgaacatgaa cgaggyatca tycttcgagc gtctgartct atgttagcta
   15951  gacgtcaagg ttacgaggag gcaaccgagc ttcttaactt acgcgatttg
   16001  ggaaagtatt tgtagttagt ttgcggacgg tggtattacg ccatcccatg
   16051  agcactgctt taagggtcgt taattgacga ctcttgatat ttactaagtt
   16101  tgaattatgg acgacgagac aaagaaattg aagaacaaaa acaaggaaac
   16151  gaaagaaggc gacgatgttg ttgcagcgga gtcttctttc ggttccttaa
   16201  acttacacat cgatccgact ctgatagcga tgaacgacgt gcgtcagtta
   16251  ggtacccaac agaacgccgc tttgaacaga gatttgttcc ttactttgaa
   16301  agggaagtat cctaatttgt ctgataaaga taaggacttt cacatagcta
   16351  tgatgttgta tcgtttagcg gttaagagtt catcattgca aagtgatgac
   16401  gacaccacgg gcataacgta cactcgggag ggcgtcgaag tggatttgtc
   16451  tgacaaactt tggactgacg tcgtgttcaa ttctaagggt atcggtaacc
   16501  gtactaacgc ccttcgagtc tggggtagaa gtaacgatgc cctttattta
   16551  gcgttttgta gacagaatcg caatttgagt tatggcggac gtccgctaga
   16601  tgcagggatt ccggccgggt atcattacct gtgtgcagat ttcttgaccg
   16651  gagctggctt gactgatttg gaatgtgctg tgtacataca agctaaagaa
   16701  caattgttga agaagcgagg ggctgatgaa gtcgtagtta ctaatgtcag
   16751  gcagcttggg aaatttaaca cacgttgatc tattgcgttg cgattctcga
   16801  tttctatcgg gatggtggag tttcatcgtg aacgtgggtg atataatcgt
   16851  tcggtttgcg ttacatgttc ctagtgaaga tatgctgaat agcttttcag
   16901  ctatatcgaa ttgtacgatc atagcagacg gtagtgcttt actaaaagac
   16951  aacactgtgg tcgactgctt agagagtatg aatcctttgg cttatttgtt
   17001  aaaattagcg aaaacgacta ctactatttg ttttactatg tctaataagg
   17051  ttctttttgg tactactaaa tctgaaccgc ttagttgttt agctatcacg
   17101  tcggatcgag ttttattcaa agttattatg ggtactaacg ctgatgattc
   17151  tcgatgtggc tgcagtattt ggttttacaa caatgggacg tttcaaaacg
   17201  ggttgacccg ttgtaacaat ctcgtcgctt tgtttagcgc gacttagaca
   17251  cgaagtgacc gttcgggttt aattgctgca atgggtattc gacgcgtgtg
   17301  gttaaagatt atggctgtaa tcacggtatt gtggtatggt aaagaacctt
   17351  ccattagcga aggttacaat gctcttatga atgatgactt taagttcatc
   17401  gatacgcact tttcaaacgt ttcttatgct aagaagtgtt acgagttggc
   17451  taaattcgac ttagactttc tacgcatcgt catcattccc ttgagcggtg
   17501  gtgcggtgaa tgaatcgcat gctgatcgca ctaacgtttc agagattgtc
   17551  gaatcgcata tgagcgaccg agacagaatg aaaatcttgt tgcgtaataa
   17601  gcggatccag attccttcgc tcttaccttg cgataactag agtctactca
   17651  gtagtacgtc tactagtata acgtattaaa cactttagtg aggagttttg
   17701  tttaaaccaa acaacatgcg agcttacttt agtgttaacg attacataag
   17751  ccttttggct aaggtcggcg cagttgtgga acgtttgtgc gatcccagcg
   17801  taactctcac ggaagtgatg gacgaaatta atgattttaa ctcgtttctc
   17851  gctttggtac actctatgaa gtcggacatg aacggcgatc atcaggatgg
   17901  tcaccatgag atgggtgaac acaaatctcg attgttgtgc aatatagagg
   17951  cgaaactgcg aatacttctc gacatcataa gacgtcggtt tactcgcgac
   18001  aagctgctct gtaccagcgc aacagatgtc atgggcttct tcgttatgag
   18051  gtacatgagt tctagtcaca ccagtttcga gtccgtaatg cgaacggagc
   18101  tgaaattagt ggttaaagcg gtactgtcgg atttatcccg cgcgcataaa
   18151  ctagatttta gcgagcgagc ctttgcggct tacggtatcc ttttacaaaa
   18201  gggtactgta gcgaccgttt gcggtcagtt tgacattaat ttagtttctc
   18251  cttcatgcgt gtaggttaat acgcttctca gaacgtgtgg ttgtattaac
   18301  taactttaat tcgaacaaat ctattgttaa aagtctgtaa gttacgatgg
   18351  acgatactag cggacaaact tttatttctg tgaacctttc tgacgaaagc
   18401  aacacagcta gtactgaaat caaaaccgta agttcggaag cggatcgctt
   18451  ggaattttta cggaaaatga atcccttcat tatcgacgct ttgatacgga
   18501  aaaataatta ccaaggcgct cgctttcgcg cgaggataat aggagtgtgc
   18551  gtggattgtg gtagaaaaca cgataaggca tcgaggactg aacgtaagtg
   18601  taaggtcaac aatacgcagt ctcagaacga ggtggcgcat atgttaatgc
   18651  acgatcccgt aaaatattta aataaaagaa aagctagagc cttttctaac
   18701  gcagagatgt ttgcgatcga tttggttatg cacaccaaag aaaggcaatt
   18751  agcggttgat ttggccgctg aaagggagaa gacgagattg gctcgtagac
   18801  acccgatgcg ttctccggaa gagactccgg aacattataa attcggtatg
   18851  actgctaagg caatgttacc ggacatcaac gctatagacg ttggtgataa
   18901  cgaagacacc tcgtcggagt acccagtaag tctgagtgtt tcgggcggag
   18951  ttctccgtga acaccacttc atctgattga agtggacgga ataagttcct
   19001  cgcggaacta tatgtcgggt tggtaaaaac ccttatgatg gtgatatatc
   19051  actagacaat aaccggatgg gtaaagtctt taaaatgatc gaggggaaaa
   19101  ttaaccatat cctctcgttg gtctaagctc ccacagagtg gtagtggtct
   19151  caagtgaggc ttaacgtatg cgtgaaccaa agaagttctc cttagagtgt
   19201  gtgttgttta cccaacacac tgtccctatg gggggccaac ataggtcca