Sequence of DPV Murine leukemia virus

Moloney murine leukemia virus, complete genome.

ACC No: AF033811

Dated: 1998-12-03 | Length: 8332 | CRC: 764216528

                !!NA_SEQUENCE 1.0
ID   AF033811   standard; genomic RNA; VRL; 8332 BP.
XX
AC   AF033811;
XX
SV   AF033811.1
XX
DT   23-JAN-1998 (Rel. 54, Created)
DT   03-DEC-1998 (Rel. 57, Last updated, Version 3)
XX
DE   Moloney murine leukemia virus, complete genome.
XX
KW   .
XX
OS   Moloney murine leukemia virus
OC   Viruses; Retroid viruses; Retroviridae; Gammaretrovirus;
OC   Murine leukemia virus.
XX
RN   [1]
RP   1-8332
RA   Petropoulos C.J.;
RT   "Appendix 2: Retroviral taxonomy, protein structure, sequences, and genetic
RT   maps";
RL   (in) Coffin J.M. (eds.);
RL   RETROVIRUSES:757-0;
RL   Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, NY, USA
RL   (1997)
XX
RN   [2]
RP   1-8332
RA   Chappey C.;
RT   ;
RL   Submitted (12-NOV-1997) to the EMBL/GenBank/DDBJ databases.
RL   NIH, NLM, Rockville Pike, Bethesda, MD 20894, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8332
FT                   /db_xref="taxon:11801"
FT                   /mol_type="genomic RNA"
FT                   /organism="Moloney murine leukemia virus"
FT   mRNA            1. .8332
FT                   /gene="gag-pol"
FT   mRNA            join(1. .205,5491. .8332)
FT                   /gene="env"
FT                   /product="gPr80"
FT   5'UTR           69. .145
FT   CDS             357. .1973
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9WJP4"
FT                   /db_xref="UniProt/TrEMBL:Q9WJP4"
FT                   /gene="gag"
FT                   /product="Pr65"
FT                   /protein_id="AAC82566.1"
FT                   /translation="MGQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPT
FT                   FNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPK
FT                   PPPPLPPSAPSLPLEPPRSTPPRSSLYPALTPSLGAKPKPQVLSDSGGPLIDLLTEDPP
FT                   PYRDPRPPPSDRDGNGGEATPAGEAPDPSPMASRLRGRREPPVADSTTSQAFPLRAGGN
FT                   GQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGE
FT                   EKQRVLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWDYTTQAGRNHLVHYRQLLLAG
FT                   LQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIW
FT                   QSAPDIGRKLERLEDLKNKTLGDLVREAEKIFNKRETPEEREERIRRETEEKEERRRTE
FT                   DEQKEKERDRRRHREMSKLLATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDC
FT                   PKKPRGPRGPRPQTSLLTLDD"
FT   CDS             join(357. .1970,1974. .5573)
FT                   /codon_start=1
FT                   /db_xref="GOA:O92808"
FT                   /db_xref="UniProt/TrEMBL:O92808"
FT                   /gene="gag-pol"
FT                   /product="Pr180"
FT                   /protein_id="AAC82568.1"
FT                   /translation="MGQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPT
FT                   FNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPK
FT                   PPPPLPPSAPSLPLEPPRSTPPRSSLYPALTPSLGAKPKPQVLSDSGGPLIDLLTEDPP
FT                   PYRDPRPPPSDRDGNGGEATPAGEAPDPSPMASRLRGRREPPVADSTTSQAFPLRAGGN
FT                   GQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGE
FT                   EKQRVLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWDYTTQAGRNHLVHYRQLLLAG
FT                   LQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIW
FT                   QSAPDIGRKLERLEDLKNKTLGDLVREAEKIFNKRETPEEREERIRRETEEKEERRRTE
FT                   DEQKEKERDRRRHREMSKLLATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDC
FT                   PKKPRGPRGPRPQTSLLTLDDGGQGQEPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQN
FT                   PGPLSDKSAWVQGATGGKRYRWTTDRKVHLATGKVTHSFLHVPDCPYPLLGRDLLTKLK
FT                   AQIHFEGSGAQVMGPMGQPLQVLTLNIEDEHRLHETSKEPDVSLGSTWLSDFPQAWAET
FT                   GGMGLAVRQAPLIIPLKATSTPVSIKQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWN
FT                   TPLLPVKKPGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDA
FT                   FFCLRLHPTSQPLFAFEWRDPEMGISGQLTWTRLPQGFKNSPTLFDEALHRDLADFRIQ
FT                   HPDLILLQYVDDLLLAATSELDCQQGTRALLQTLGNLGYRASAKKAQICQKQVKYLGYL
FT                   LKEGQRWLTEARKETVMGQPTPKTPRQLREFLGTAGFCRLWIPGFAEMAAPLYPLTKTG
FT                   TLFNWGPDQQKAYQEIKQALLTAPALGLPDLTKPFELFVDEKQGYAKGVLTQKLGPWRR
FT                   PVAYLSKKLDPVAAGWPPCLRMVAAIAVLTKDAGKLTMGQPLVILAPHAVEALVKQPPD
FT                   RWLSNARMTHYQALLLDTDRVQFGPVVALNPATLLPLPEEGLQHNCLDILAEAHGTRPD
FT                   LTDQPLPDADHTWYTDGSSLLQEGQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALT
FT                   QALKMAEGKKLNVYTDSRYAFATAHIHGEIYRRRGLLTSEGKEIKNKDEILALLKALFL
FT                   PKRLSIIHCPGHQKGHSAEARGNRMADQAARKAAITETPDTSTLLIENSSPYTSEHFHY
FT                   TVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKMKALLER
FT                   SHSPYYMLNRDRTLKNITETCKACAQVNASKSAVKQGTRVRGHRPGTHWEIDFTEIKPG
FT                   LYGYKYLLVFIDTFSGWIEAFPTKKETAKVVTKKLLEEIFPRFGMPQVLGTDNGPAFVS
FT                   KVSQTVADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLAL
FT                   YRARNTPGPHGLTPYEILYGAPPPLVNFPDPDMTRVTNSPSLQAHLQALYLVQHEVWRP
FT                   LAAAYQEQLDRPVVPHPYRVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAA
FT                   WIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP"
FT   mat_peptide     360. .749
FT                   /gene="gag"
FT                   /product="p15 MA"
FT   mat_peptide     750. .1001
FT                   /gene="gag"
FT                   /product="pp12"
FT   mat_peptide     1002. .1790
FT                   /gene="gag"
FT                   /product="p30 CA"
FT   mat_peptide     1791. .1958
FT                   /gene="gag"
FT                   /product="p10 NC"
FT   mat_peptide     join(1959. .1970,1974. .2336)
FT                   /product="p14 PR"
FT   mat_peptide     2337. .4349
FT                   /gene="pol"
FT                   /product="p80 RT"
FT   mat_peptide     4350. .5570
FT                   /gene="pol"
FT                   /product="p46 IN"
FT   CDS             5513. .7510
FT                   /codon_start=1
FT                   /gene="env"
FT                   /product="gPr80"
FT                   /protein_id="AAC82567.1"
FT                   /translation="MARSTLSKPLKNKVNPRGPLIPLILLMLRGVSTASPGSSPHQVYN
FT                   ITWEVTNGDRETVWATSGNHPLWTWWPDLTPDLCMLAHHGPSYWGLEYQSPFSSPPGPP
FT                   CCSGGSSPGCSRDCEEPLTSLTPRCNTAWNRLKLDQTTHKSNEGFYVCPGPHRPRESKS
FT                   CGGPDSFYCAYWGCETTGRAYWKPSSSWDFITVNNNLTSDQAVQVCKDNKWCNPLVIRF
FT                   TDAGRRVTSWTTGHYWGLRLYVSGQDPGLTFGIRLRYQNLGPRVPIGPNPVLADQQPLS
FT                   KPKPVKSPSVTKPPSGTPLSPTQLPPAGTENRLLNLVDGAYQALNLTSPDKTQECWLCL
FT                   VAGPPYYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCIGAVPKTHQALCNT
FT                   TQTSSRGSYYLVAPTGTMWACSTGLTPCISTTILNLTTDYCVLVELWPRVTYHSPSYVY
FT                   GLFERSNRHKREPVSLTLALLLGGLTMGGIAAGIGTGTTALMATQQFQQLQAAVQDDLR
FT                   EVEKSISNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHTGLVRDSM
FT                   AKLRERLNQRQKLFESTQGWFEGLFNRSPWFTTLISTIMGPLIVLLMILLFGPCILNRL
FT                   VQFVKDRISVVQALVLTQQYHQLKPIEYEP"
FT   mat_peptide     5612. .6919
FT                   /product="gp70 SU"
FT   mat_peptide     6920. .7507
FT                   /product="p15E"
FT                   /product="p12E TM"
FT   3'UTR           7818. .8264
XX
SQ   Sequence 8332 BP; 2143 A; 2395 C; 2025 G; 1769 T; 0 other;

AF033811  Length: 8332  January 7, 2005 14:54  Type: N  Check: 6254  ..

       1  tatgcgcctg cgtcggtact agttagctaa ctagctctgt atctggcgga
      51  cccgtggtgg aactgacgag ttcggaacac ccggccgcaa ccctgggaga
     101  cgtcccaggg acttcggggg ccgtttttgt ggcccgacct gagtccaaaa
     151  atcccgatcg ttttggactc tttggtgcac cccccttaga ggagggatat
     201  gtggttctgg taggagacga gaacctaaaa cagttcccgc ctccgtctga
     251  atttttgctt tcggtttggg accgaagccg cgccgcgcgt cttgtctgct
     301  gcagcatcgt tctgtgttgt ctctgtctga ctgtgtttct gtatttgtct
     351  gagaatatgg gccagactgt taccactccc ttaagtttga ccttaggtca
     401  ctggaaagat gtcgagcgga tcgctcacaa ccagtcggta gatgtcaaga
     451  agagacgttg ggttaccttc tgctctgcag aatggccaac ctttaacgtc
     501  ggatggccgc gagacggcac ctttaaccga gacctcatca cccaggttaa
     551  gatcaaggtc ttttcacctg gcccgcatgg acacccagac caggtcccct
     601  acatcgtgac ctgggaagcc ttggcttttg acccccctcc ctgggtcaag
     651  ccctttgtac accctaagcc tccgcctcct cttcctccat ccgccccgtc
     701  tctccccctt gaacctcctc gttcgacccc gcctcgatcc tccctttatc
     751  cagccctcac tccttctcta ggcgccaaac ctaaacctca agttctttct
     801  gacagtgggg ggccgctcat cgacctactt acagaagacc ccccgcctta
     851  tagggaccca agaccacccc cttccgacag ggacggaaat ggtggagaag
     901  cgacccctgc gggagaggca ccggacccct ccccaatggc atctcgccta
     951  cgtgggagac gggagccccc tgtggccgac tccactacct cgcaggcatt
    1001  ccccctccgc gcaggaggaa acggacagct tcaatactgg ccgttctcct
    1051  cttctgacct ttacaactgg aaaaataata acccttcttt ttctgaagat
    1101  ccaggtaaac tgacagctct gatcgagtct gttctcatca cccatcagcc
    1151  cacctgggac gactgtcagc agctgttggg gactctgctg accggagaag
    1201  aaaaacaacg ggtgctctta gaggctagaa aggcggtgcg gggcgatgat
    1251  gggcgcccca ctcaactgcc caatgaagtc gatgccgctt ttcccctcga
    1301  gcgcccagac tgggattaca ccacccaggc aggtaggaac cacctagtcc
    1351  actatcgcca gttgctccta gcgggtctcc aaaacgcggg cagaagcccc
    1401  accaatttgg ccaaggtaaa aggaataaca caagggccca atgagtctcc
    1451  ctcggccttc ctagagagac ttaaggaagc ctatcgcagg tacactcctt
    1501  atgaccctga ggacccaggg caagaaacta atgtgtctat gtctttcatt
    1551  tggcagtctg ccccagacat tgggagaaag ttagagaggt tagaagattt
    1601  aaaaaacaag acgcttggag atttggttag agaggcagaa aagatcttta
    1651  ataaacgaga aaccccggaa gaaagagagg aacgtatcag gagagaaaca
    1701  gaggaaaaag aagaacgccg taggacagag gatgagcaga aagagaaaga
    1751  aagagatcgt aggagacata gagagatgag caagctattg gccactgtcg
    1801  ttagtggaca gaaacaggat agacagggag gagaacgaag gaggtcccaa
    1851  ctcgatcgcg accagtgtgc ctactgcaaa gaaaaggggc actgggctaa
    1901  agattgtccc aagaaaccac gaggacctcg gggaccaaga ccccagacct
    1951  ccctcctgac cctagatgac tagggaggtc agggtcagga gcccccccct
    2001  gaacccagga taaccctcaa agtcgggggg caacccgtca ccttcctggt
    2051  agatactggg gcccaacact ccgtgctgac ccaaaatcct ggacccctaa
    2101  gtgataagtc tgcctgggtc caaggggcta ctggaggaaa gcggtatcgc
    2151  tggaccacgg atcgcaaagt acatctagct accggtaagg tcacccactc
    2201  tttcctccat gtaccagact gtccctatcc tctgttagga agagatttgc
    2251  tgactaaact aaaagcccaa atccactttg agggatcagg agctcaggtt
    2301  atgggaccaa tggggcagcc cctgcaagtg ttgaccctaa atatagaaga
    2351  tgagcatcgg ctacatgaga cctcaaaaga gccagatgtt tctctagggt
    2401  ccacatggct gtctgatttt cctcaggcct gggcggaaac cgggggcatg
    2451  ggactggcag ttcgccaagc tcctctgatc atacctctga aagcaacctc
    2501  tacccccgtg tccataaaac aataccccat gtcacaagaa gccagactgg
    2551  ggatcaagcc ccacatacag agactgttgg accagggaat actggtaccc
    2601  tgccagtccc cctggaacac gcccctgcta cccgttaaga aaccagggac
    2651  taatgattat aggcctgtcc aggatctgag agaagtcaac aagcgggtgg
    2701  aagacatcca ccccaccgtg cccaaccctt acaacctctt gagcgggctc
    2751  ccaccgtccc accagtggta cactgtgctt gatttaaagg atgccttttt
    2801  ctgcctgaga ctccacccca ccagtcagcc tctcttcgcc tttgagtgga
    2851  gagatccaga gatgggaatc tcaggacaat tgacctggac cagactccca
    2901  cagggtttca aaaacagtcc caccctgttt gatgaggcac tgcacagaga
    2951  cctagcagac ttccggatcc agcacccaga cttgatcctg ctacagtacg
    3001  tggatgactt actgctggcc gccacttctg agctagactg ccaacaaggt
    3051  actcgggccc tgttacaaac cctagggaac ctcgggtatc gggcctcggc
    3101  caagaaagcc caaatttgcc agaaacaggt caagtatctg gggtatcttc
    3151  taaaagaggg tcagagatgg ctgactgagg ccagaaaaga gactgtgatg
    3201  gggcagccta ctccgaagac ccctcgacaa ctaagggagt tcctagggac
    3251  ggcaggcttc tgtcgcctct ggatccctgg gtttgcagaa atggcagccc
    3301  ccttgtaccc tctcaccaaa acggggactc tgtttaattg gggcccagac
    3351  caacaaaagg cctatcaaga aatcaagcaa gctcttctaa ctgccccagc
    3401  cctggggttg ccagatttga ctaagccctt tgaactcttt gtcgacgaga
    3451  agcagggcta cgccaaaggt gtcctaacgc aaaaactggg accttggcgt
    3501  cggccggtgg cctacctgtc caaaaagcta gacccagtag cagctgggtg
    3551  gcccccttgc ctacggatgg tagcagccat tgccgtactg acaaaggatg
    3601  caggcaagct aaccatggga cagccactag tcattctggc cccccatgca
    3651  gtagaggcac tagtcaaaca accccccgac cgctggcttt ccaacgcccg
    3701  gatgactcac tatcaggcct tgcttttgga cacggaccgg gtccagttcg
    3751  gaccggtggt agccctgaac ccggctacgc tgctcccact gcctgaggaa
    3801  gggctgcaac acaactgcct tgatatcctg gccgaagccc acggaacccg
    3851  acccgaccta acggaccagc cgctcccaga cgccgaccac acctggtaca
    3901  cggatggaag cagtctctta caagagggac agcgtaaggc gggagctgcg
    3951  gtgaccaccg agaccgaggt aatctgggct aaagccctgc cagccgggac
    4001  atccgctcag cgggctgaac tgatagcact cacccaggcc ctaaagatgg
    4051  cagaaggtaa gaagctaaat gtttatactg atagccgtta tgcttttgct
    4101  actgcccata tccatggaga aatatacaga aggcgtgggt tgctcacatc
    4151  agaaggcaaa gagatcaaaa ataaagacga gatcttggcc ctactaaaag
    4201  ccctctttct gcccaaaaga cttagcataa tccattgtcc aggacatcaa
    4251  aagggacaca gcgccgaggc tagaggcaac cggatggctg accaagcggc
    4301  ccgaaaggca gccatcacag agactccaga cacctctacc ctcctcatag
    4351  aaaattcatc accctacacc tcagaacatt ttcattacac agtgactgat
    4401  ataaaggacc taaccaagtt gggggccatt tatgataaaa caaagaagta
    4451  ttgggtctac caaggaaaac ctgtgatgcc tgaccagttt acttttgaat
    4501  tattagactt tcttcatcag ctgactcacc tcagcttctc aaaaatgaag
    4551  gctctcctag agagaagcca cagtccctac tacatgctga accgggatcg
    4601  aacactcaaa aatatcactg agacctgcaa agcttgtgca caagtcaacg
    4651  ccagcaagtc tgccgttaaa cagggaacta gggtccgcgg gcatcggccc
    4701  ggcactcatt gggagatcga tttcaccgag ataaagcccg gattgtatgg
    4751  ctataaatat cttctagttt ttatagatac cttttctggc tggatagaag
    4801  ccttcccaac caagaaagaa accgccaagg tcgtaaccaa gaagctacta
    4851  gaggagatct tccccaggtt cggcatgcct caggtattgg gaactgacaa
    4901  tgggcctgcc ttcgtctcca aggtgagtca gacagtggcc gatctgttgg
    4951  ggattgattg gaaattacat tgtgcataca gaccccaaag ctcaggccag
    5001  gtagaaagaa tgaatagaac catcaaggag actttaacta aattaacgct
    5051  tgcaactggc tctagagact gggtgctcct actcccctta gccctgtacc
    5101  gagcccgcaa cacgccgggc ccccatggcc tcaccccata tgagatctta
    5151  tatggggcac ccccgcccct tgtaaacttc cctgaccctg acatgacaag
    5201  agttactaac agcccctctc tccaagctca cttacaggct ctctacttag
    5251  tccagcacga agtctggaga cctctggcgg cagcctacca agaacaactg
    5301  gaccgaccgg tggtacctca cccttaccga gtcggcgaca cagtgtgggt
    5351  ccgccgacac cagactaaga acctagaacc tcgctggaaa ggaccttaca
    5401  cagtcctgct gaccaccccc accgccctca aagtagacgg catcgcagct
    5451  tggatacacg ccgcccacgt gaaggctgcc gaccccgggg gtggaccatc
    5501  ctctagactg acatggcgcg ttcaacgctc tcaaaacccc ttaaaaataa
    5551  ggttaacccg cgaggccccc taatcccctt aattcttctg atgctcagag
    5601  gggtcagtac tgcttcgccc ggctccagtc ctcatcaagt ctataatatc
    5651  acctgggagg taaccaatgg agatcgggag acggtatggg caacttctgg
    5701  caaccaccct ctgtggacct ggtggcctga ccttacccca gatttatgta
    5751  tgttagccca ccatggacca tcttattggg ggctagaata tcaatcccct
    5801  ttttcttctc ccccggggcc cccttgttgc tcagggggca gcagcccagg
    5851  ctgttccaga gactgcgaag aacctttaac ctccctcacc cctcggtgca
    5901  acactgcctg gaacagactc aagctagacc agacaactca taaatcaaat
    5951  gagggatttt atgtttgccc cgggccccac cgcccccgag aatccaagtc
    6001  atgtgggggt ccagactcct tctactgtgc ctattggggc tgtgagacaa
    6051  ccggtagagc ttactggaag ccctcctcat catgggattt catcacagta
    6101  aacaacaatc tcacctctga ccaggctgtc caggtatgca aagataataa
    6151  gtggtgcaac cccttagtta ttcggtttac agacgccggg agacgggtta
    6201  cttcctggac cacaggacat tactggggct tacgtttgta tgtctccgga
    6251  caagatccag ggcttacatt tgggatccga ctcagatacc aaaatctagg
    6301  accccgcgtc ccaatagggc caaaccccgt tctggcagac caacagccac
    6351  tctccaagcc caaacctgtt aagtcgcctt cagtcaccaa accacccagt
    6401  gggactcctc tctcccctac ccaacttcca ccggcgggaa cggaaaatag
    6451  gctgctaaac ttagtagacg gagcctacca agccctcaac ctcaccagtc
    6501  ctgacaaaac ccaagagtgc tggttgtgtc tagtagcggg acccccctac
    6551  tacgaagggg ttgccgtcct gggtacctac tccaaccata cctctgctcc
    6601  agccaactgc tccgtggcct cccaacacaa gttgaccctg tccgaagtga
    6651  ccggacaggg actctgcata ggagcagttc ccaaaacaca tcaggcccta
    6701  tgtaatacca cccagacaag cagtcgaggg tcctattatc tagttgcccc
    6751  tacaggtacc atgtgggctt gtagtaccgg gcttactcca tgcatctcca
    6801  ccaccatact gaaccttacc actgattatt gtgttcttgt cgaactctgg
    6851  ccaagagtca cctatcattc ccccagctat gtttacggcc tgtttgagag
    6901  atccaaccga cacaaaagag aaccggtgtc gttaaccctg gccctattat
    6951  tgggtggact aaccatgggg ggaattgccg ctggaatagg aacagggact
    7001  actgctctaa tggccactca gcaattccag cagctccaag ccgcagtaca
    7051  ggatgatctc agggaggttg aaaaatcaat ctctaaccta gaaaagtctc
    7101  tcacttccct gtctgaagtt gtcctacaga atcgaagggg cctagacttg
    7151  ttatttctaa aagaaggagg gctgtgtgct gctctaaaag aagaatgttg
    7201  cttctatgcg gaccacacag gactagtgag agacagcatg gccaaattga
    7251  gagagaggct taatcagaga cagaaactgt ttgagtcaac tcaaggatgg
    7301  tttgagggac tgtttaacag atccccttgg tttaccacct tgatatctac
    7351  cattatggga cccctcattg tactcctaat gattttgctc ttcggaccct
    7401  gcattcttaa tcgattagtc caatttgtta aagacaggat atcagtggtc
    7451  caggctctag ttttgactca acaatatcac cagctgaagc ctatagagta
    7501  cgagccatag ataaaataaa agattttatt tagtctccag aaaaaggggg
    7551  gaatgaaaga ccccacctgt aggtttggca agctagctta agtaacgcca
    7601  ttttgcaagg catggaaaaa tacataactg agaatagaga agttcagatc
    7651  aaggtcagga acagatggaa cagctgaata tgggccaaac aggatatctg
    7701  tggtaagcag ttcctgcccc ggctcagggc caagaacaga tggaacagct
    7751  gaatatgggc caaacaggat atctgtggta agcagttcct gccccggctc
    7801  agggccaaga acagatggtc cccagatgcg gtccagccct cagcagtttc
    7851  tagagaacca tcagatgttt ccagggtgcc ccaaggacct gaaatgaccc
    7901  tgtgccttat ttgaactaac caatcagttc gcttctcgct tctgttcgcg
    7951  cgcttctgct ccccgagctc aataaaagag cccacaaccc ctcactcggg
    8001  gcgccagtcc tccgattgac tgagtcgccc gggtacccgt gtatccaata
    8051  aaccctcttg cagttgcagc gccagtcctc cgattgactg agtcgcccgg
    8101  gtacccgtgt atccaataaa ccctcttgca gttgcatccg acttgtggtc
    8151  tcgctgttcc ttgggagggt ctcctctgag tgattgacta cccgtcagcg
    8201  ggggtctttc atttgggggc tcgtccggga tcgggagacc cctgcccagg
    8251  gaccaccgac ccaccaccgg gaggtaagct ggccagcaac ttatctgtgt
    8301  ctgtccgatt gtctagtgtc tatgactgat tt