Sequence of DPV Moloney murine sarcoma virus

Moloney murine sarcoma virus, complete genome.

ACC No: AF033813

Dated: 1998-12-03 | Length: 5833 | CRC: -434135273

                !!NA_SEQUENCE 1.0
ID   AF033813   standard; genomic RNA; VRL; 5833 BP.
XX
AC   AF033813;
XX
SV   AF033813.1
XX
DT   23-JAN-1998 (Rel. 54, Created)
DT   03-DEC-1998 (Rel. 57, Last updated, Version 3)
XX
DE   Moloney murine sarcoma virus, complete genome.
XX
KW   .
XX
OS   Moloney murine sarcoma virus
OC   Viruses; Retroid viruses; Retroviridae; Gammaretrovirus.
XX
RN   [1]
RP   1-5833
RA   Petropoulos C.J.;
RT   "Appendix 2: Retroviral taxonomy, protein structure, sequences, and genetic
RT   maps";
RL   (in) Coffin J.M. (eds.);
RL   RETROVIRUSES:757-0;
RL   Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, NY, USA
RL   (1997)
XX
RN   [2]
RP   1-5833
RA   Chappey C.;
RT   ;
RL   Submitted (12-NOV-1997) to the EMBL/GenBank/DDBJ databases.
RL   NIH, NLM, Rockville Pike, Bethesda, MD 20894, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5833
FT                   /db_xref="taxon:11809"
FT                   /mol_type="genomic RNA"
FT                   /organism="Moloney murine sarcoma virus"
FT   mRNA            join(1. .145,3408. .5833)
FT                   /product="MOS"
FT   5'UTR           70. .145
FT   mRNA            557. .2173
FT                   /gene="gag"
FT                   /product="Pr65"
FT   CDS             557. .2173
FT                   /codon_start=1
FT                   /db_xref="GOA:O56222"
FT                   /db_xref="HSSP:Q9WJP4"
FT                   /db_xref="UniProt/TrEMBL:O56222"
FT                   /gene="gag"
FT                   /product="Pr65"
FT                   /protein_id="AAC82570.1"
FT                   /translation="MGQTVTTPLSLTLDHWKDVERLAHNQSVDVKKRRWVTFCSAEWPT
FT                   FNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPK
FT                   PPPPLLPSAPSLPLEPPLSTPPQSSLYPALTPSLGAKPKPQVLSDSGGPLIDLLTEDPP
FT                   PYRDPRPPPSDRDGDSGEATPAGEAPDPSPMASRLRGRREPPVADSTTSQAFPLRTGGN
FT                   GQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGE
FT                   EKQRVLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWEYTTQAGRNHLVHYRQLLIAG
FT                   LQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIW
FT                   QSAPDIGRKLERLEDLRNKTLGDLVREAERIFNKRETPEEREERIRREREEKEERRRTE
FT                   DEQKEKERDRRRHREMSRLLATVVSGQRQDRQEGERRRSQLDCDQCTYCEEQGHWAKDC
FT                   PKRPRGPRGPRPQTSLLTLDD"
FT   mat_peptide     560. .952
FT                   /gene="gag"
FT                   /product="MA"
FT   mat_peptide     1202. .1993
FT                   /gene="gag"
FT                   /product="CA"
FT   mat_peptide     1991. .2170
FT                   /gene="gag"
FT                   /product="NC"
FT   CDS             3390. .4514
FT                   /codon_start=1
FT                   /db_xref="GOA:Q77YG7"
FT                   /db_xref="UniProt/TrEMBL:Q77YG7"
FT                   /product="MOS"
FT                   /protein_id="AAC82571.1"
FT                   /translation="MAHSTPCSQTSLAVPNHFSLVSHVTVPSEGVMPSPLSLCRYLPRE
FT                   LSPSVDSRSCSIPLVAPRKAGKLFLGTTPPRAPGLPRRLAWFSIDWEQVCLMHRLGSGG
FT                   FGSVYKATYHGVPVAIKQVNKCTEDLRASQRSFWAELNIAGLRHDNIVRVVAASTRTPE
FT                   DSNSLGTIIMEFGGNVTLHQVIYDATRSPEPLSCRKQLSLGKCLKYSLDVVNGLLFLHS
FT                   QSILHLDLKPANILISEQDVCKISDFGCSQKLQVLRGRQASPPHIGGTYTHQAPEILKG
FT                   EIATPKADIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAVFTASLTGKA
FT                   LQNIIQSCWEARGLQRPSAELLQRDLKAFRGTLG"
FT   mat_peptide     3405. .4511
FT                   /product="MOS"
FT   3'UTR           4800. .5244
XX
SQ   Sequence 5833 BP; 1427 A; 1673 C; 1484 G; 1249 T; 0 other;

AF033813  Length: 5833  January 7, 2005 14:54  Type: N  Check: 2044  ..

       1  attcccaata aagcctcttg ctgtttgcat ccgaatcgtg gtctcgctgt
      51  tccttgggag ggtctcctct gagtgattga ctacccacga cgggggtctt
     101  tcatttgggg gctcgtccgg gatttggaga cccctgccca gggaccaccg
     151  acccaccacc gggaggtaag ctggccagca acttatctgt gtctgtccga
     201  ttgtctagtg tctatgtttg atgttatgcg cctgcgtctg tactagttag
     251  ctaactagct ctgtatctgg cggacccgtg gtggaactga cgagttctga
     301  acacccggcc gcaaccctgg gagacgtccc agggactttg ggggccgttt
     351  ttgtggcccg acctgaggaa gggagtcgat gtggaatccg accccgtcag
     401  gatatgtggt tctggtagga gacgagaacc taaaacagtt cccgcctccg
     451  tctgaatttt tgctttcggt ttggaaccga agccgcgcgt cttgtctgct
     501  gcagcatcgt tctgtgttgt ctctgtctga ctgtgtttct gtatttgtct
     551  gaaaatatgg gccagactgt taccactccc ttaagtttga ccttagatca
     601  ctggaaagat gtcgagcggc tcgctcacaa ccagtcggta gatgtcaaga
     651  agagacgttg ggttaccttc tgctctgcag aatggccaac ctttaacgtc
     701  ggatggccgc gagacggcac ctttaaccga gacctcatca cccaggttaa
     751  gatcaaggtc ttttcacctg gcccgcatgg acacccagac caggtcccct
     801  acatcgtgac ctgggaagcc ttggcttttg acccccctcc ctgggtcaag
     851  ccctttgtac accctaagcc tccgcctcct cttcttccat ccgcgccgtc
     901  tctccccctt gaacctcctc tttcgacccc gcctcaatcc tccctttatc
     951  cagccctcac tccttctttg ggcgccaaac ctaaacctca agttctttct
    1001  gacagtgggg ggccgctcat cgacctactt acagaagacc ccccgcctta
    1051  tagggaccca agaccacccc cttccgacag ggacggagat agtggagaag
    1101  cgacccctgc gggagaggca ccggacccct ccccaatggc atctcgcctg
    1151  cgtgggagac gggagccccc tgtggccgac tccactacct cgcaggcatt
    1201  ccccctccgc acaggaggaa acggacagct tcaatactgg ccgttctcct
    1251  cttctgacct ttacaactgg aaaaataata acccttcttt ttctgaagat
    1301  ccaggtaaac tgacagctct gatcgagtct gtcctcatca cccatcagcc
    1351  cacctgggac gactgtcagc agctgttggg gactctgctg accggggaag
    1401  aaaaacaacg ggtgctctta gaggctagaa aggcggtgcg gggcgatgat
    1451  gggcgcccca ctcaactgcc caatgaagtc gatgccgctt ttcccctcga
    1501  gcgcccagac tgggagtaca ccacccaggc aggtaggaac cacctagtcc
    1551  actatcgcca gttgctcata gcgggtctcc aaaacgcggg cagaagcccc
    1601  accaatttgg ccaaggtaaa aggaataaca caagggccca atgagtctcc
    1651  ctcggccttc ctagagagac ttaaggaagc ctatcgcagg tacactcctt
    1701  atgaccctga ggacccaggg caagaaacta atgtgtctat gtctttcatt
    1751  tggcagtctg ccccagacat tgggagaaag ttagagaggt tagaagattt
    1801  gagaaacaag acgcttggag atttggttag agaggcagaa aggatcttta
    1851  ataaacgaga aaccccggaa gaaagagagg aacgtatcag gagagaaaga
    1901  gaggaaaagg aagaacgccg taggacagag gatgagcaga aagagaaaga
    1951  aagagatcgt aggagacata gagagatgag caggctattg gccactgtcg
    2001  ttagtggaca gagacaggat agacaggaag gagaacgaag gaggtcccaa
    2051  ctcgactgcg accagtgtac ctactgcgaa gaacaagggc actgggctaa
    2101  agattgtccc aagagaccac gaggacctcg gggaccaaga ccccagacct
    2151  ccctcctgac cctagatgac tagggaggtc agggtcagga gcccccccct
    2201  gaacccagga taaccctcaa agtcgggggg caacccgtca ccttcctggt
    2251  agatactggg gcccagacca acaaaaggcc tatcaagaaa tcaagcaagt
    2301  tcttctaact gccccagccc tggggttgcc agatttgact aagccctttg
    2351  aactctttgt cgacgagaag cagggctacg ccaaaggtgt cctaacgcaa
    2401  aaactgggac cttggcgtcg gccggtggcc tacctgtcca aacagctaga
    2451  cccagtagca gctgggtgac ccccttgcct acggatggta gcagccattg
    2501  ccgtactgac aaaggatgca ggcaagctaa ccatgggaca gccactagtc
    2551  attctggccc cccatgcagt agaggcacta gtcaaacaac cccccgaccg
    2601  ctggctttcc aacgcccgga tgactcacta tcaggccttg cttttggaca
    2651  cggaccgggt ccagttcaga ccggtggtag ccctgaaccc ggctacgctg
    2701  ctcccactgc ctgagaaagg gctgcaacac aactgccttg atatcctggc
    2751  cgaagctcat ggaacccgac ccgacctaac ggaccagccg ctcccagacg
    2801  ccgaccacac ctggtacacg gatggaagca gtcttttaca agagggacag
    2851  cgtaaggcgg gagctgcggt gaccaccgag accgagaagc cttcccaacc
    2901  aagaaaaaaa accgccaagg tcgtaaatct tccccaggtt cggcatgctt
    2951  caggtattgg gaactgacaa tgggcctgcc ttcgtctcca aggtgagtca
    3001  gacagtggcc gatctgttgg ggattgattg gaaattacat tgtgcataca
    3051  gaccccaaag ctcaggccag gtagaaagaa taaatagaac catcaaggag
    3101  actttaacta aattaacgct tgcaactggc tctagggact gggtgctcct
    3151  actcccctta gccctgtatc gagcccgcaa cacgccgggc ccccatggcc
    3201  tcaccccata tgagatctta tgtggggcac ccccgcccct tgtaaacttc
    3251  cctgaccctg acatgacaag agttactaac agcccctctc tccaagctca
    3301  catacaggct ctctacttag tccagcacga agtctggaga cctctggcgg
    3351  cagcctacca agaacaactg gaccatcctc tagactgaca tggcgcattc
    3401  aacgccatgc tcccaaactt ccctggctgt tcctaatcat ttctccctag
    3451  tgtctcatgt gactgtccca tctgagggtg taatgccttc gcctctaagc
    3501  ctgtgtcgct acctccctcg tgagctgtcg ccatcggtag actcgcggtc
    3551  ctgcagcatt cctttggtgg ccccgaggaa ggcagggaag ctcttcctgg
    3601  ggaccactcc tcctcgggct cccggactgc cacgccggct ggcctggttc
    3651  tccatagact gggaacaggt atgtctgatg cataggctgg gctctggagg
    3701  gtttggctcg gtgtacaaag ccacttacca cggtgttcct gtggccatca
    3751  agcaagtaaa caagtgcacc gaggacctac gtgcatccca gcggagtttc
    3801  tgggctgaac tgaacattgc aggactacgc cacgacaaca tagttcgggt
    3851  tgtggctgcc agcacgcgca cgcccgaaga ctccaacagc ctaggtacca
    3901  taatcatgga gtttgggggc aacgtgactc tacaccaagt catctacgat
    3951  gccacccgct caccggagcc tctcagctgc agaaaacaac taagtttggg
    4001  gaagtgcctc aagtattccc tagatgttgt taacggcctg ctttttctcc
    4051  actcacaaag cattttgcac ttggacctga agccagcgaa cattttgatt
    4101  agtgagcagg acgtttgtaa gatcagtgac ttcggctgct cccagaagct
    4151  gcaggttctg cggggccggc aggcgtcccc tccccacata gggggcacgt
    4201  acacgcacca agctccggag atcctaaaag gagagattgc cacgcccaaa
    4251  gctgacatct actcttttgg aatcaccctg tggcagatga ctaccagaga
    4301  ggtgccttac tccggcgaac ctcagtacgt gcagtatgca gtggtagcct
    4351  acaatctgcg tccctcactg gcaggagcgg tgttcaccgc ctccctgact
    4401  ggaaaggcac tgcagaacat catccagagc tgctgggagg cccgcggcct
    4451  gcagaggccg agtgcagaac tgctccaaag ggacctcaag gctttccgag
    4501  ggacactagg ctgactccat cgagccagtg tagagataag cttttgtttc
    4551  tgtttatttt ttatgggacc ccttattgta ctcctaatga ttttgctctt
    4601  cggaccctgc attcttaatc gattagtcca atttgttaaa gacaggatat
    4651  cagtggtcca ggctctagct ttgactcaac aatatcacca gctgaagcct
    4701  atagagtacg agccatagtt aaaataaaag attttattta gtctccagaa
    4751  aaagggggga atgaaagacc ccacccgtag gtggcaagct agcttaagta
    4801  acgccacttt gcaaggcatg gaaaaataca taactgagaa tagaaaagtt
    4851  cagatcaagg tcaggaacaa agaaacagct gaataccaaa caggatatct
    4901  gtggtaagcg gttcctgccc cggctcaggg ccaagaacag atgagacagc
    4951  tgagtgatgg gccaaacagg atatctgtgg taagcagttc ctgccccggc
    5001  tcggggccaa gaacagatgg tccccagatg cggtccagcc ctcagcagtt
    5051  tctagtgaat catcagatgt ttccagggtg ccccaaggac ctgaaaatga
    5101  ccctgtacct tatttgaact aaccaatcag ttcgcttctc gcttctgttc
    5151  gcgcgcttcc gctctccgag ctcaataaaa gagcccacaa cccctcactc
    5201  ggcgcgccag tcttccgata gactgcgtcg cccgggtacc cgtattccca
    5251  ataaagcctc ttgctgtttg catccgaatc gtggtctcgc tgttccttgg
    5301  gagggtctcc tctgagtgat tgactaccca cgacgggggt ctttcattaa
    5351  atgaaagacc ccacccgtag gtggcaagct agcttaagta acgccacttt
    5401  gcaaggcatg gaaaaataca taactgagaa tagaaaagtt cagatcaagg
    5451  tcaggaacaa agaaacagct gaataccaaa caggatatct gtggtaagcg
    5501  gttcctgccc cggctcaggg ccaagaacag atgagacagc tgagtgatgg
    5551  gccaaacagg atatctgtgg taagcagttc ctgccccggc tcggggccaa
    5601  gaacagatgg tccccagatg cggtccagcc ctcagcagtt tctagtgaat
    5651  catcagatgt ttccagggtg ccccaaggac ctgaaaatga ccctgtacct
    5701  tatttgaact aaccaatcag ttcgcttctc gcttctgttc gcgcgcttcc
    5751  gctctccgag ctcaataaaa gagcccacaa cccctcactc ggcgcgccag
    5801  tcttccgata gactgcgtcg cccgggtacc cgt